DIP Database of Interacting Proteins 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ dip@mbi.ucla.edu A type III effector antagonizes death receptor signalling during bacterial gut infection. A type III effector antagonizes death receptor signalling during bacterial gut infection. Nature 2013 imex curation Pearson JS., Giogha C., Ong SY., Kennedy CL., Kelly M., Robinson KS., Lung TW., Mansell A., Riedmaier P., Oates CV., Zaid A., Mühlen S., Crepin VF., Marches O., Ang CS., Williamson NA., O'Reilly LA., Bankovacki A., Nachbur U., Infusini G., Webb AI., Silke J., Strasser A., Frankel G., Hartland EL. Only protein-protein interactions in vitro In vitro glycosylase assay glycosylase assay predetermined predetermined participant predetermined Pearson JS., Giogha C., Ong SY., Kennedy CL., Kelly M., Robinson KS., Lung TW., Mansell A., Riedmaier P., Oates CV., Zaid A., Mühlen S., Crepin VF., Marches O., Ang CS., Williamson NA., O'Reilly LA., Bankovacki A., Nachbur U., Infusini G., Webb AI., Silke J., Strasser A., Frankel G., Hartland EL. DIP original experiment: DIP-256031X Nature 2013 IMEx A type III effector antagonizes death receptor signalling during bacterial gut infection. A type III effector antagonizes death receptor signalling during bacterial gut infection. A type III effector antagonizes death receptor signalling during bacterial gut infection. Nature 2013 imex curation Pearson JS., Giogha C., Ong SY., Kennedy CL., Kelly M., Robinson KS., Lung TW., Mansell A., Riedmaier P., Oates CV., Zaid A., Mühlen S., Crepin VF., Marches O., Ang CS., Williamson NA., O'Reilly LA., Bankovacki A., Nachbur U., Infusini G., Webb AI., Silke J., Strasser A., Frankel G., Hartland EL. Only protein-protein interactions yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid predetermined predetermined participant predetermined Pearson JS., Giogha C., Ong SY., Kennedy CL., Kelly M., Robinson KS., Lung TW., Mansell A., Riedmaier P., Oates CV., Zaid A., Mühlen S., Crepin VF., Marches O., Ang CS., Williamson NA., O'Reilly LA., Bankovacki A., Nachbur U., Infusini G., Webb AI., Silke J., Strasser A., Frankel G., Hartland EL. DIP original experiment: DIP-256020X Nature 2013 IMEx A type III effector antagonizes death receptor signalling during bacterial gut infection. A type III effector antagonizes death receptor signalling during bacterial gut infection. A type III effector antagonizes death receptor signalling during bacterial gut infection. Nature 2013 imex curation Pearson JS., Giogha C., Ong SY., Kennedy CL., Kelly M., Robinson KS., Lung TW., Mansell A., Riedmaier P., Oates CV., Zaid A., Mühlen S., Crepin VF., Marches O., Ang CS., Williamson NA., O'Reilly LA., Bankovacki A., Nachbur U., Infusini G., Webb AI., Silke J., Strasser A., Frankel G., Hartland EL. Only protein-protein interactions human Homo sapiens Human anti tag coip anti tag coimmunoprecipitation anti tag coip anti tag western anti tag western blot anti tag western Pearson JS., Giogha C., Ong SY., Kennedy CL., Kelly M., Robinson KS., Lung TW., Mansell A., Riedmaier P., Oates CV., Zaid A., Mühlen S., Crepin VF., Marches O., Ang CS., Williamson NA., O'Reilly LA., Bankovacki A., Nachbur U., Infusini G., Webb AI., Silke J., Strasser A., Frankel G., Hartland EL. DIP original experiment: DIP-256025X Nature 2013 IMEx A type III effector antagonizes death receptor signalling during bacterial gut infection. A type III effector antagonizes death receptor signalling during bacterial gut infection. A type III effector antagonizes death receptor signalling during bacterial gut infection. Nature 2013 imex curation Pearson JS., Giogha C., Ong SY., Kennedy CL., Kelly M., Robinson KS., Lung TW., Mansell A., Riedmaier P., Oates CV., Zaid A., Mühlen S., Crepin VF., Marches O., Ang CS., Williamson NA., O'Reilly LA., Bankovacki A., Nachbur U., Infusini G., Webb AI., Silke J., Strasser A., Frankel G., Hartland EL. Only protein-protein interactions human Homo sapiens Human pull down pull down western blot western blot Immuno blot Immuno blot Pearson JS., Giogha C., Ong SY., Kennedy CL., Kelly M., Robinson KS., Lung TW., Mansell A., Riedmaier P., Oates CV., Zaid A., Mühlen S., Crepin VF., Marches O., Ang CS., Williamson NA., O'Reilly LA., Bankovacki A., Nachbur U., Infusini G., Webb AI., Silke J., Strasser A., Frankel G., Hartland EL. DIP original experiment: DIP-256033X Nature 2013 IMEx A type III effector antagonizes death receptor signalling during bacterial gut infection. A type III effector antagonizes death receptor signalling during bacterial gut infection. A type III effector antagonizes death receptor signalling during bacterial gut infection. Nature 2013 imex curation Pearson JS., Giogha C., Ong SY., Kennedy CL., Kelly M., Robinson KS., Lung TW., Mansell A., Riedmaier P., Oates CV., Zaid A., Mühlen S., Crepin VF., Marches O., Ang CS., Williamson NA., O'Reilly LA., Bankovacki A., Nachbur U., Infusini G., Webb AI., Silke J., Strasser A., Frankel G., Hartland EL. Only protein-protein interactions yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence Pearson JS., Giogha C., Ong SY., Kennedy CL., Kelly M., Robinson KS., Lung TW., Mansell A., Riedmaier P., Oates CV., Zaid A., Mühlen S., Crepin VF., Marches O., Ang CS., Williamson NA., O'Reilly LA., Bankovacki A., Nachbur U., Infusini G., Webb AI., Silke J., Strasser A., Frankel G., Hartland EL. DIP original experiment: DIP-256017X Nature 2013 IMEx A type III effector antagonizes death receptor signalling during bacterial gut infection. A type III effector antagonizes death receptor signalling during bacterial gut infection. A type III effector antagonizes death receptor signalling during bacterial gut infection. Nature 2013 imex curation Pearson JS., Giogha C., Ong SY., Kennedy CL., Kelly M., Robinson KS., Lung TW., Mansell A., Riedmaier P., Oates CV., Zaid A., Mühlen S., Crepin VF., Marches O., Ang CS., Williamson NA., O'Reilly LA., Bankovacki A., Nachbur U., Infusini G., Webb AI., Silke J., Strasser A., Frankel G., Hartland EL. Only protein-protein interactions human Homo sapiens Human anti tag coip anti tag coimmunoprecipitation anti tag coip anti tag western anti tag western blot anti tag western Pearson JS., Giogha C., Ong SY., Kennedy CL., Kelly M., Robinson KS., Lung TW., Mansell A., Riedmaier P., Oates CV., Zaid A., Mühlen S., Crepin VF., Marches O., Ang CS., Williamson NA., O'Reilly LA., Bankovacki A., Nachbur U., Infusini G., Webb AI., Silke J., Strasser A., Frankel G., Hartland EL. DIP original experiment: DIP-256023X Nature 2013 IMEx A type III effector antagonizes death receptor signalling during bacterial gut infection. A type III effector antagonizes death receptor signalling during bacterial gut infection. A type III effector antagonizes death receptor signalling during bacterial gut infection. Nature 2013 imex curation Pearson JS., Giogha C., Ong SY., Kennedy CL., Kelly M., Robinson KS., Lung TW., Mansell A., Riedmaier P., Oates CV., Zaid A., Mühlen S., Crepin VF., Marches O., Ang CS., Williamson NA., O'Reilly LA., Bankovacki A., Nachbur U., Infusini G., Webb AI., Silke J., Strasser A., Frankel G., Hartland EL. Only protein-protein interactions in vitro In vitro glycosylase assay glycosylase assay predetermined predetermined participant predetermined Pearson JS., Giogha C., Ong SY., Kennedy CL., Kelly M., Robinson KS., Lung TW., Mansell A., Riedmaier P., Oates CV., Zaid A., Mühlen S., Crepin VF., Marches O., Ang CS., Williamson NA., O'Reilly LA., Bankovacki A., Nachbur U., Infusini G., Webb AI., Silke J., Strasser A., Frankel G., Hartland EL. DIP original experiment: DIP-256030X Nature 2013 IMEx A type III effector antagonizes death receptor signalling during bacterial gut infection. A type III effector antagonizes death receptor signalling during bacterial gut infection. A type III effector antagonizes death receptor signalling during bacterial gut infection. Nature 2013 imex curation Pearson JS., Giogha C., Ong SY., Kennedy CL., Kelly M., Robinson KS., Lung TW., Mansell A., Riedmaier P., Oates CV., Zaid A., Mühlen S., Crepin VF., Marches O., Ang CS., Williamson NA., O'Reilly LA., Bankovacki A., Nachbur U., Infusini G., Webb AI., Silke J., Strasser A., Frankel G., Hartland EL. Only protein-protein interactions human Homo sapiens Human anti tag coip anti tag coimmunoprecipitation anti tag coip anti tag western anti tag western blot anti tag western Pearson JS., Giogha C., Ong SY., Kennedy CL., Kelly M., Robinson KS., Lung TW., Mansell A., Riedmaier P., Oates CV., Zaid A., Mühlen S., Crepin VF., Marches O., Ang CS., Williamson NA., O'Reilly LA., Bankovacki A., Nachbur U., Infusini G., Webb AI., Silke J., Strasser A., Frankel G., Hartland EL. DIP original experiment: DIP-256026X Nature 2013 IMEx A type III effector antagonizes death receptor signalling during bacterial gut infection. A type III effector antagonizes death receptor signalling during bacterial gut infection. A type III effector antagonizes death receptor signalling during bacterial gut infection. Nature 2013 imex curation Pearson JS., Giogha C., Ong SY., Kennedy CL., Kelly M., Robinson KS., Lung TW., Mansell A., Riedmaier P., Oates CV., Zaid A., Mühlen S., Crepin VF., Marches O., Ang CS., Williamson NA., O'Reilly LA., Bankovacki A., Nachbur U., Infusini G., Webb AI., Silke J., Strasser A., Frankel G., Hartland EL. Only protein-protein interactions human Homo sapiens Human anti tag coip anti tag coimmunoprecipitation anti tag coip anti tag western anti tag western blot anti tag western Pearson JS., Giogha C., Ong SY., Kennedy CL., Kelly M., Robinson KS., Lung TW., Mansell A., Riedmaier P., Oates CV., Zaid A., Mühlen S., Crepin VF., Marches O., Ang CS., Williamson NA., O'Reilly LA., Bankovacki A., Nachbur U., Infusini G., Webb AI., Silke J., Strasser A., Frankel G., Hartland EL. DIP original experiment: DIP-256024X Nature 2013 IMEx A type III effector antagonizes death receptor signalling during bacterial gut infection. A type III effector antagonizes death receptor signalling during bacterial gut infection. A type III effector antagonizes death receptor signalling during bacterial gut infection. Nature 2013 imex curation Pearson JS., Giogha C., Ong SY., Kennedy CL., Kelly M., Robinson KS., Lung TW., Mansell A., Riedmaier P., Oates CV., Zaid A., Mühlen S., Crepin VF., Marches O., Ang CS., Williamson NA., O'Reilly LA., Bankovacki A., Nachbur U., Infusini G., Webb AI., Silke J., Strasser A., Frankel G., Hartland EL. Only protein-protein interactions yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid predetermined predetermined participant predetermined Pearson JS., Giogha C., Ong SY., Kennedy CL., Kelly M., Robinson KS., Lung TW., Mansell A., Riedmaier P., Oates CV., Zaid A., Mühlen S., Crepin VF., Marches O., Ang CS., Williamson NA., O'Reilly LA., Bankovacki A., Nachbur U., Infusini G., Webb AI., Silke J., Strasser A., Frankel G., Hartland EL. DIP original experiment: DIP-256019X Nature 2013 IMEx A type III effector antagonizes death receptor signalling during bacterial gut infection. A type III effector antagonizes death receptor signalling during bacterial gut infection. A type III effector antagonizes death receptor signalling during bacterial gut infection. Nature 2013 imex curation Pearson JS., Giogha C., Ong SY., Kennedy CL., Kelly M., Robinson KS., Lung TW., Mansell A., Riedmaier P., Oates CV., Zaid A., Mühlen S., Crepin VF., Marches O., Ang CS., Williamson NA., O'Reilly LA., Bankovacki A., Nachbur U., Infusini G., Webb AI., Silke J., Strasser A., Frankel G., Hartland EL. Only protein-protein interactions yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence Pearson JS., Giogha C., Ong SY., Kennedy CL., Kelly M., Robinson KS., Lung TW., Mansell A., Riedmaier P., Oates CV., Zaid A., Mühlen S., Crepin VF., Marches O., Ang CS., Williamson NA., O'Reilly LA., Bankovacki A., Nachbur U., Infusini G., Webb AI., Silke J., Strasser A., Frankel G., Hartland EL. DIP original experiment: DIP-256015X Nature 2013 IMEx A type III effector antagonizes death receptor signalling during bacterial gut infection. A type III effector antagonizes death receptor signalling during bacterial gut infection. A type III effector antagonizes death receptor signalling during bacterial gut infection. Nature 2013 imex curation Pearson JS., Giogha C., Ong SY., Kennedy CL., Kelly M., Robinson KS., Lung TW., Mansell A., Riedmaier P., Oates CV., Zaid A., Mühlen S., Crepin VF., Marches O., Ang CS., Williamson NA., O'Reilly LA., Bankovacki A., Nachbur U., Infusini G., Webb AI., Silke J., Strasser A., Frankel G., Hartland EL. Only protein-protein interactions human Homo sapiens Human anti tag coip anti tag coimmunoprecipitation anti tag coip anti tag western anti tag western blot anti tag western Pearson JS., Giogha C., Ong SY., Kennedy CL., Kelly M., Robinson KS., Lung TW., Mansell A., Riedmaier P., Oates CV., Zaid A., Mühlen S., Crepin VF., Marches O., Ang CS., Williamson NA., O'Reilly LA., Bankovacki A., Nachbur U., Infusini G., Webb AI., Silke J., Strasser A., Frankel G., Hartland EL. DIP original experiment: DIP-256028X Nature 2013 IMEx A type III effector antagonizes death receptor signalling during bacterial gut infection. A type III effector antagonizes death receptor signalling during bacterial gut infection. A type III effector antagonizes death receptor signalling during bacterial gut infection. Nature 2013 imex curation Pearson JS., Giogha C., Ong SY., Kennedy CL., Kelly M., Robinson KS., Lung TW., Mansell A., Riedmaier P., Oates CV., Zaid A., Mühlen S., Crepin VF., Marches O., Ang CS., Williamson NA., O'Reilly LA., Bankovacki A., Nachbur U., Infusini G., Webb AI., Silke J., Strasser A., Frankel G., Hartland EL. Only protein-protein interactions human Homo sapiens Human anti tag coip anti tag coimmunoprecipitation anti tag coip anti tag western anti tag western blot anti tag western Pearson JS., Giogha C., Ong SY., Kennedy CL., Kelly M., Robinson KS., Lung TW., Mansell A., Riedmaier P., Oates CV., Zaid A., Mühlen S., Crepin VF., Marches O., Ang CS., Williamson NA., O'Reilly LA., Bankovacki A., Nachbur U., Infusini G., Webb AI., Silke J., Strasser A., Frankel G., Hartland EL. DIP original experiment: DIP-256032X Nature 2013 IMEx A type III effector antagonizes death receptor signalling during bacterial gut infection. A type III effector antagonizes death receptor signalling during bacterial gut infection. A type III effector antagonizes death receptor signalling during bacterial gut infection. Nature 2013 imex curation Pearson JS., Giogha C., Ong SY., Kennedy CL., Kelly M., Robinson KS., Lung TW., Mansell A., Riedmaier P., Oates CV., Zaid A., Mühlen S., Crepin VF., Marches O., Ang CS., Williamson NA., O'Reilly LA., Bankovacki A., Nachbur U., Infusini G., Webb AI., Silke J., Strasser A., Frankel G., Hartland EL. Only protein-protein interactions human Homo sapiens Human anti tag coip anti tag coimmunoprecipitation anti tag coip anti tag western anti tag western blot anti tag western Pearson JS., Giogha C., Ong SY., Kennedy CL., Kelly M., Robinson KS., Lung TW., Mansell A., Riedmaier P., Oates CV., Zaid A., Mühlen S., Crepin VF., Marches O., Ang CS., Williamson NA., O'Reilly LA., Bankovacki A., Nachbur U., Infusini G., Webb AI., Silke J., Strasser A., Frankel G., Hartland EL. DIP original experiment: DIP-256022X Nature 2013 IMEx A type III effector antagonizes death receptor signalling during bacterial gut infection. A type III effector antagonizes death receptor signalling during bacterial gut infection. A type III effector antagonizes death receptor signalling during bacterial gut infection. Nature 2013 imex curation Pearson JS., Giogha C., Ong SY., Kennedy CL., Kelly M., Robinson KS., Lung TW., Mansell A., Riedmaier P., Oates CV., Zaid A., Mühlen S., Crepin VF., Marches O., Ang CS., Williamson NA., O'Reilly LA., Bankovacki A., Nachbur U., Infusini G., Webb AI., Silke J., Strasser A., Frankel G., Hartland EL. Only protein-protein interactions human Homo sapiens Human anti tag coip anti tag coimmunoprecipitation anti tag coip anti tag western anti tag western blot anti tag western Pearson JS., Giogha C., Ong SY., Kennedy CL., Kelly M., Robinson KS., Lung TW., Mansell A., Riedmaier P., Oates CV., Zaid A., Mühlen S., Crepin VF., Marches O., Ang CS., Williamson NA., O'Reilly LA., Bankovacki A., Nachbur U., Infusini G., Webb AI., Silke J., Strasser A., Frankel G., Hartland EL. DIP original experiment: DIP-256029X Nature 2013 IMEx A type III effector antagonizes death receptor signalling during bacterial gut infection. A type III effector antagonizes death receptor signalling during bacterial gut infection. A type III effector antagonizes death receptor signalling during bacterial gut infection. Nature 2013 imex curation Pearson JS., Giogha C., Ong SY., Kennedy CL., Kelly M., Robinson KS., Lung TW., Mansell A., Riedmaier P., Oates CV., Zaid A., Mühlen S., Crepin VF., Marches O., Ang CS., Williamson NA., O'Reilly LA., Bankovacki A., Nachbur U., Infusini G., Webb AI., Silke J., Strasser A., Frankel G., Hartland EL. Only protein-protein interactions human Homo sapiens Human anti tag coip anti tag coimmunoprecipitation anti tag coip anti tag western anti tag western blot anti tag western Pearson JS., Giogha C., Ong SY., Kennedy CL., Kelly M., Robinson KS., Lung TW., Mansell A., Riedmaier P., Oates CV., Zaid A., Mühlen S., Crepin VF., Marches O., Ang CS., Williamson NA., O'Reilly LA., Bankovacki A., Nachbur U., Infusini G., Webb AI., Silke J., Strasser A., Frankel G., Hartland EL. DIP original experiment: DIP-256027X Nature 2013 IMEx A type III effector antagonizes death receptor signalling during bacterial gut infection. A type III effector antagonizes death receptor signalling during bacterial gut infection. A type III effector antagonizes death receptor signalling during bacterial gut infection. Nature 2013 imex curation Pearson JS., Giogha C., Ong SY., Kennedy CL., Kelly M., Robinson KS., Lung TW., Mansell A., Riedmaier P., Oates CV., Zaid A., Mühlen S., Crepin VF., Marches O., Ang CS., Williamson NA., O'Reilly LA., Bankovacki A., Nachbur U., Infusini G., Webb AI., Silke J., Strasser A., Frankel G., Hartland EL. Only protein-protein interactions human Homo sapiens Human anti tag coip anti tag coimmunoprecipitation anti tag coip anti tag western anti tag western blot anti tag western Pearson JS., Giogha C., Ong SY., Kennedy CL., Kelly M., Robinson KS., Lung TW., Mansell A., Riedmaier P., Oates CV., Zaid A., Mühlen S., Crepin VF., Marches O., Ang CS., Williamson NA., O'Reilly LA., Bankovacki A., Nachbur U., Infusini G., Webb AI., Silke J., Strasser A., Frankel G., Hartland EL. DIP original experiment: DIP-256021X Nature 2013 IMEx A type III effector antagonizes death receptor signalling during bacterial gut infection. A type III effector antagonizes death receptor signalling during bacterial gut infection. A type III effector antagonizes death receptor signalling during bacterial gut infection. Nature 2013 imex curation Pearson JS., Giogha C., Ong SY., Kennedy CL., Kelly M., Robinson KS., Lung TW., Mansell A., Riedmaier P., Oates CV., Zaid A., Mühlen S., Crepin VF., Marches O., Ang CS., Williamson NA., O'Reilly LA., Bankovacki A., Nachbur U., Infusini G., Webb AI., Silke J., Strasser A., Frankel G., Hartland EL. Only protein-protein interactions yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid predetermined predetermined participant predetermined Pearson JS., Giogha C., Ong SY., Kennedy CL., Kelly M., Robinson KS., Lung TW., Mansell A., Riedmaier P., Oates CV., Zaid A., Mühlen S., Crepin VF., Marches O., Ang CS., Williamson NA., O'Reilly LA., Bankovacki A., Nachbur U., Infusini G., Webb AI., Silke J., Strasser A., Frankel G., Hartland EL. DIP original experiment: DIP-256016X Nature 2013 IMEx A type III effector antagonizes death receptor signalling during bacterial gut infection. A type III effector antagonizes death receptor signalling during bacterial gut infection. A type III effector antagonizes death receptor signalling during bacterial gut infection. Nature 2013 imex curation Pearson JS., Giogha C., Ong SY., Kennedy CL., Kelly M., Robinson KS., Lung TW., Mansell A., Riedmaier P., Oates CV., Zaid A., Mühlen S., Crepin VF., Marches O., Ang CS., Williamson NA., O'Reilly LA., Bankovacki A., Nachbur U., Infusini G., Webb AI., Silke J., Strasser A., Frankel G., Hartland EL. Only protein-protein interactions yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid predetermined predetermined participant predetermined Pearson JS., Giogha C., Ong SY., Kennedy CL., Kelly M., Robinson KS., Lung TW., Mansell A., Riedmaier P., Oates CV., Zaid A., Mühlen S., Crepin VF., Marches O., Ang CS., Williamson NA., O'Reilly LA., Bankovacki A., Nachbur U., Infusini G., Webb AI., Silke J., Strasser A., Frankel G., Hartland EL. DIP original experiment: DIP-256018X Nature 2013 IMEx A type III effector antagonizes death receptor signalling during bacterial gut infection. casp8_human Caspase-8 CASP8 MCH5 ICE-like apoptotic protease 5 MORT1-associated ced-3 homolog FADD-homologous ICE/ced-3-like protease FADD-like ICE Apoptotic cysteine protease Apoptotic protease Mch-5 CAP4 protein protein human Homo sapiens Human MDFSRNLYDIGEQLDSEDLASLKFLSLDYIPQRKQEPIKDALMLFQRLQEKRMLEESNLSFLKELLFRINRLDLLITYLNTRKEEMERELQTPGRAQISAYRVMLYQISEEVSRSELRSFKFLLQEEISKCKLDDDMNLLDIFIEMEKRVILGEGKLDILKRVCAQINKSLLKIINDYEEFSKERSSSLEGSPDEFSNGEELCGVMTISDSPREQDSESQTLDKVYQMKSKPRGYCLIINNHNFAKAREKVPKLHSIRDRNGTHLDAGALTTTFEELHFEIKPHDDCTVEQIYEILKIYQLMDHSNMDCFICCILSHGDKGIIYGTDGQEAPIYELTSQFTGLKCPSLAGKPKVFFIQACQGDNYQKGIPVETDSEEQPYLEMDLSSPQTRYIPDEADFLLGMATVNNCVSYRNPAEGTWYIQSLCQSLRERCPRGDDILTILTEVNYEVSNKDDKKNMGKQMPQPTFTLRKKLVFPSD DIP protein Q14790 original sequence version: 184 DIP protein Q14790 original sequence version: 135 DIP protein Q14790 original sequence version: 136 DIP protein Q14790 original sequence version: 147 DIP protein Q14790 original sequence version: 146 DIP protein Q14790 original sequence version: 170 DIP protein Q14790 original sequence version: 198 DIP protein Q14790-1 original sequence version: 197 DIP protein Q14790 original sequence version: 158 7A5FEAA6B39B582F ehecnleb1 Hypothetical protein Z4328 protein protein escherichia coli o157:h7 str. edl933 Escherichia coli O157:H7 str. EDL933 fadd_human FAS-associated death domain protein FAS-associating death domain-containing protein Mediator of receptor induced toxicity FADD MORT1 GIG3 Growth-inhibiting gene 3 protein protein protein human Homo sapiens Human MDPFLVLLHSVSSSLSSSELTELKFLCLGRVGKRKLERVQSGLDLFSMLLEQNDLEPGHTELLRELLASLRRHDLLRRVDDFEAGAAAGAAPGEEDLCAAFNVICDNVGKDWRRLARQLKVSDTKIDSIEDRYPRNLTERVRESLRIWKNTEKENATVAHLVGALRSCQMNLVADLVQEVQQARDLQNRSGAMSPMSWNSDASTSEAS DIP protein Q13158 original sequence version: 155 DIP protein Q13158 original sequence version: 130 DIP protein Q13158 original sequence version: 110 DIP protein Q13158 original sequence version: 118 DIP protein Q13158 original sequence version: 141 DIP protein Q13158 original sequence version: 166 0E65E2F852E83507 p25445-1 Tumor necrosis factor receptor superfamily member 6 FAS APT1 FAS1 TNFRSF6 Apo-1 antigen Apoptosis-mediating surface antigen FAS FASLG receptor protein protein human Homo sapiens Human MLGIWTLLPLVLTSVARLSSKSVNAQVTDINSKGLELRKTVTTVETQNLEGLHHDGQFCHKPCPPGERKARDCTVNGDEPDCVPCQEGKEYTDKAHFSSKCRRCRLCDEGHGLEVEINCTRTQNTKCRCKPNFFCNSTVCEHCDPCTKCEHGIIKECTLTSNTKCKEEGSRSNLGWLCLLLLPIPLIVWVKRKEVQKTCRKHRKENQGSHESPTLNPETVAINLSDVDLSKYITTIAGVMTLSQVKGFVRKNGVNEAKIDEIKNDNVQDTAEQKVQLLRNWHQLHGKKEAYDTLIKDLKKANLCTLAEKIQTIILKDITSDSENSNFRNEIQSLV DIP protein P25445-1 original sequence version: 126 DIP protein P25445 original sequence version: 149 DIP protein P25445-1 original sequence version: 145 DIP protein P25445 original sequence version: 153 DIP protein P25445-1 original sequence version: 153 DIP protein P25445 original sequence version: 152 DIP protein P25445-1 original sequence version: 204 DIP protein P25445 original sequence version: 176 d2tt37_citri nleB1 ROD_10831 protein protein Citrobacter freundii biotype 4280 Citrobacter rodentium (strain ICC168) Citrobacter freundii biotype 4280 MLSPLNVLQFNFRGETALSDSAPLQTVSFAGKDYSMEPIDEKTPILFQWFEARPERYGKGEVPILNTKEHPYLSNIINAAKIENERVIGVLVDGDFTYEQRKEFLSLEDEHQNIKIIYRENVDFSMYDKKLSDIYLENIHEQESYPASERDNYLLGLLREELKNIPYGKDSLIESYAEKRGHTWFDFFRNLAVLKGGGLFTETGKTGCHNISPCGGCIYLDADMIITDKLGVLYAPDGIAVYVDCNDNRKSLENGAIVVNRSNHPALLAGLDIMKSKVDAHPYYDGVGKGLKRHFNYSSLQDYNVFCNFIEFKHKNIIPNTSMYTNSSW DIP protein D2TT37 original sequence version: 14 ripk1_human Receptor-interacting serine/threonine-protein kinase 1 RIPK1 RIP Cell death protein RIP RIP1 Receptor-interacting protein 1 protein protein human Homo sapiens Human MQPDMSLNVIKMKSSDFLESAELDSGGFGKVSLCFHRTQGLMIMKTVYKGPNCIEHNEALLEEAKMMNRLRHSRVVKLLGVIIEEGKYSLVMEYMEKGNLMHVLKAEMSTPLSVKGRIILEIIEGMCYLHGKGVIHKDLKPENILVDNDFHIKIADLGLASFKMWSKLNNEEHNELREVDGTAKKNGGTLYYMAPEHLNDVNAKPTEKSDVYSFAVVLWAIFANKEPYENAICEQQLIMCIKSGNRPDVDDITEYCPREIISLMKLCWEANPEARPTFPGIEEKFRPFYLSQLEESVEEDVKSLKKEYSNENAVVKRMQSLQLDCVAVPSSRSNSATEQPGSLHSSQGLGMGPVEESWFAPSLEHPQEENEPSLQSKLQDEANYHLYGSRMDRQTKQQPRQNVAYNREEERRRRVSHDPFAQQRPYENFQNTEGKGTAYSSAASHGNAVHQPSGLTSQPQVLYQNNGLYSSHGFGTRPLDPGTAGPRVWYRPIPSHMPSLHNIPVPETNYLGNTPTMPFSSLPPTDESIKYTIYNSTGIQIGAYNYMEIGGTSSSLLDSTNTNFKEEPAAKYQAIFDNTTSLTDKHLDPIRENLGKHWKNCARKLGFTQSQIDEIDHDYERDGLKEKVYQMLQKWVMREGIKGATVGKLAQALHQCSRIDLLSSLIYVSQN DIP protein Q13546 original sequence version: 158 DIP protein Q13546-1 original sequence version: 140 DIP protein Q13546 original sequence version: 146 DIP protein Q13546-1 original sequence version: 146 DIP protein Q13546 original sequence version: 134 DIP protein Q13546 original sequence version: 109 976E2428D525A9B2 tradd_human Tumor necrosis factor receptor type 1-associated DEATH domain protein TRADD TNFRSF1A-associated via death domain protein protein human Homo sapiens Human MAAGQNGHEEWVGSAYLFVESSLDKVVLSDAYAHPQQKVAVYRALQAALAESGGSPDVLQMLKIHRSDPQLIVQLRFCGRQPCGRFLRAYREGALRAALQRSLAAALAQHSVPLQLELRAGAERLDALLADEERCLSCILAQQPDRLRDEELAELEDALRNLKCGSGARGGDGEVASAPLQPPVPSLSEVKPPPPPPPAQTFLFQGQPVVNRPLSLKDQQTFARSVGLKWRKVGRSLQRGCRALRDPALDSLAYEYEREGLYEQAFQLLRRFVQAEGRRATLQRLVEALEENELTSLAEDLLGLTDPNGGLA DIP protein Q15628 original sequence version: 92 DIP protein Q15628 original sequence version: 132 DIP protein Q15628 original sequence version: 156 DIP protein Q15628 original sequence version: 77 5645D7E63E5FF05A nleb1_eco27 Protein-arginine N-acetylglucosaminyltransferase NleB1 nleB1 Non-LEE-encoded type III effector B1 nleB E2348C_3231 protein protein eco27 Escherichia coli O127:H6 (strain E2348/69 / EPEC) MLSSLNVLQSSFRGKTALSNSTLLQKVSFAGKEYSLEPIDERTPILFQWFEARPERYEKGEVPILNTKEHPYLSNIINAAKIENERIIGVLVDGNFTYEQKKEFLNLENEHQNIKIIYRADVDFSMYDKKLSDIYLENIHKQESYPASERDNYLLGLLREELKNIPEGKDSLIESYAEKREHTWFDFFRNLAILKAGSLFTETGKTGCHNISPCSGCIYLDADMIITDKLGVLYAPDGIAVHVDCNDEIKSLENGAIVVNRSNHPALLAGLDIMKSKVDAHPYYDGLGKGIKRHFNYSSLHNYNAFCDFIEFKHENIIPNTSMYTSSSW DIP protein B7UI21 original sequence version: 20 nleb2_eco27 Protein-arginine N-acetylglucosaminyltransferase NleB2 nleB2 Non-LEE-encoded type III effector B2 E2348C_1041 protein protein eco27 Escherichia coli O127:H6 (strain E2348/69 / EPEC) MLSPIRTTFHNSVNIVQSSPCQTVSFAGKEYELKVIDEKTPILFQWFEPNPERYKKDEVPIVNTKQHPYLDNVTNAARIESDRMIGIFVDGDFSVNQKTAFSKLERDFENVMIIYREDVDFSMYDRKLSDIYHDIICEQRLRTEDKRDEYLLNLLEKELREISKAQDSLISMYAKKRNHAWFDFFRNLALLKAGEIFRCTYNTKNHGISFGEGCIYLDMDMILTGKLGTIYAPDGISMHVDRRNDSVNIENSAIIVNRSNHPALLEGLSFMHSKVDAHPYYDGLGKGVKKYFNFTPLHNYNHFCDFIEFNHPNIIMNTSQYTCSSW DIP protein B7UNX3 original sequence version: 19 tnfl6_human Tumor necrosis factor ligand superfamily member 6 Fas antigen ligand CD95L Apoptosis antigen ligand FASLG APT1LG1 FASL TNFSF6 CD95 ligand protein protein human Homo sapiens Human MQQPFNYPYPQIYWVDSSASSPWAPPGTVLPCPTSVPRRPGQRRPPPPPPPPPLPPPPPPPPLPPLPLPPLKKRGNHSTGLCLLVMFFMVLVALVGLGLGMFQLFHLQKELAELRESTSQMHTASSLEKQIGHPSPPPEKKELRKVAHLTGKSNSRSMPLEWEDTYGIVLLSGVKYKKGGLVINETGLYFVYSKVYFRGQSCNNLPLSHKVYMRNSKYPQDLVMMEGKMMSYCTTGQMWARSSYLGAVFNLTSADHLYVNVSELSLVNFEESQTFFGLYKL DIP protein P48023 original sequence version: 165 DIP protein P48023-1 original sequence version: 126 DIP protein P48023-1 original sequence version: 130 DIP protein P48023 original sequence version: 152 A8A6EB358246E9BB faslg-casp8-1 4 22 unspecified role unspecified role prey prey human Homo sapiens Human 20 unspecified role unspecified role prey prey human Homo sapiens Human 23 unspecified role unspecified role prey prey human Homo sapiens Human 29 unspecified role unspecified role bait bait Fc-tag Fc-tag fc-igg tag fc-igg tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range human Homo sapiens Human association association b7ui21_eco27-fadd-1 11 22 unspecified role unspecified role prey prey yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 27 unspecified role unspecified role bait bait yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast physical association physical association ehecnleb1-ripk1-1 2 21 unspecified role unspecified role bait bait yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 25 unspecified role unspecified role prey prey yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast physical association physical association b7ui21_eco27-tradd-3 12 26 unspecified role unspecified role prey prey Flag-tag Flag-tag flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged c-term range C-terminal range c-term range c-term range C-terminal range c-term range human Homo sapiens Human 27 unspecified role unspecified role bait bait HA-tag HA-tag ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range human Homo sapiens Human physical association physical association b7ui21_eco27-fadd-2 17 22 unspecified role unspecified role prey prey Region 97-208 Region 97-208 required to bind necessary binding region required to bind deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain Flag-tag Flag-tag flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged c-term range C-terminal range c-term range c-term range C-terminal range c-term range human Homo sapiens Human 27 unspecified role unspecified role bait bait EGFP-tag EGFP-tag egfp tag enhanced green fluorescent protein tag enhanced green fluorescent protein EGFP enhanced green fluorescent protein EGFP egfp tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range human Homo sapiens Human physical association physical association b7ui21_eco27-fadd-3 9 22 unspecified role unspecified role prey prey Flag-tag Flag-tag flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged c-term range C-terminal range c-term range c-term range C-terminal range c-term range human Homo sapiens Human 27 unspecified role unspecified role bait bait EGFP-tag EGFP-tag egfp tag enhanced green fluorescent protein tag enhanced green fluorescent protein EGFP enhanced green fluorescent protein EGFP egfp tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range human Homo sapiens Human physical association physical association b7ui21_eco27-fadd-4 18 22 unspecified role unspecified role prey prey Region 97-208 Region 97-208 sufficient to bind sufficient binding region sufficient to bind deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 27 unspecified role unspecified role bait bait yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast physical association physical association b7unx3_eco27-ripk1-1 13 28 unspecified role unspecified role bait bait EGFP-tag EGFP-tag egfp tag enhanced green fluorescent protein tag enhanced green fluorescent protein EGFP enhanced green fluorescent protein EGFP egfp tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range human Homo sapiens Human 25 unspecified role unspecified role prey prey Flag-tag Flag-tag flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged c-term range C-terminal range c-term range c-term range C-terminal range c-term range human Homo sapiens Human physical association physical association b7ui21_eco27-ripk1-1 15 25 unspecified role unspecified role prey prey Flag-tag Flag-tag flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged c-term range C-terminal range c-term range c-term range C-terminal range c-term range human Homo sapiens Human 27 unspecified role unspecified role bait bait HA-tag HA-tag ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range human Homo sapiens Human physical association physical association b7ui21_eco27-tradd-4 3 26 unspecified role unspecified role prey prey Flag-tag Flag-tag flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged c-term range C-terminal range c-term range c-term range C-terminal range c-term range human Homo sapiens Human 27 unspecified role unspecified role bait bait EGFP-tag EGFP-tag egfp tag enhanced green fluorescent protein tag enhanced green fluorescent protein EGFP enhanced green fluorescent protein EGFP egfp tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range human Homo sapiens Human physical association physical association b7ui21_eco27-ripk1-2 5 25 unspecified role unspecified role prey prey yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 27 unspecified role unspecified role bait bait yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast physical association physical association ehecnleb1-fadd-1 14 21 unspecified role unspecified role bait bait EGFP-tag EGFP-tag egfp tag enhanced green fluorescent protein tag enhanced green fluorescent protein EGFP enhanced green fluorescent protein EGFP egfp tag n-terminal n-terminal position amino-terminus n-terminus n-term n-term amino-terminus n-terminus n-terminal n-terminal n-terminal position amino-terminus n-terminus n-term n-term amino-terminus n-terminus n-terminal human Homo sapiens Human 22 unspecified role unspecified role prey prey Region 97-208 Region 97-208 required to bind necessary binding region required to bind deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain Flag-tag Flag-tag flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged c-term range C-terminal range c-term range c-term range C-terminal range c-term range human Homo sapiens Human physical association physical association b7ui21_eco27-ripk1-3 19 25 unspecified role unspecified role prey prey Region 583-671 Region 583-671 sufficient to bind sufficient binding region sufficient to bind deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 27 unspecified role unspecified role bait bait yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast physical association physical association b7ui21_eco27-fadd-5 7 22 enzyme target enzyme target substrate substrate unspecified role unspecified role R117-GlcNAc R117-GlcNAc omega-n-glucosyl-l-arginine omega-N-glucosyl-L-arginine (2S)-2-amino-5-(beta-D-glucopyranosyl[imino(methylamino)methyl]amino)pentanoic acid NG-beta-D-glucosylarginine omega-N-(beta-D-glucosyl)-L-arginine omega-N-glucosyl-L-arginine omega-N-glycosyl-L-arginine Hex Hexose CARBOHYD N-linked (Glc) arginine modified residue ms mass detection of residue modification modified residue ms certain certain sequence position certain certain certain sequence position certain Q13158:p.Arg117Ala R117A mutation disrupting rate mutation disrupting interaction rate mutation disrupting rate alanine scanning alanine scanning certain certain sequence position certain certain certain sequence position certain R A This feature has been corrected as a result of our quality control procedures. The original label was 'R117A'. Wed May 02 14:31:11 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'arg117ala' Tue Jun 30 17:04:24 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Arg117Ala' ecolx Escherichia coli 27 enzyme enzyme unspecified role unspecified role ecolx Escherichia coli glycosylation glycosylation reaction glycosylation b7ui21_eco27-ripk1-4 8 25 unspecified role unspecified role prey prey Flag-tag Flag-tag flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged c-term range C-terminal range c-term range c-term range C-terminal range c-term range human Homo sapiens Human 27 unspecified role unspecified role bait bait EGFP-tag EGFP-tag egfp tag enhanced green fluorescent protein tag enhanced green fluorescent protein EGFP enhanced green fluorescent protein EGFP egfp tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range human Homo sapiens Human physical association physical association ehecnleb1-fadd-2 10 21 unspecified role unspecified role bait bait yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 22 unspecified role unspecified role prey prey yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast physical association physical association nleb1-fadd-1 6 24 unspecified role unspecified role bait bait EGFP-tag EGFP-tag egfp tag enhanced green fluorescent protein tag enhanced green fluorescent protein EGFP enhanced green fluorescent protein EGFP egfp tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range human Homo sapiens Human 22 unspecified role unspecified role prey prey Region 97-208 Region 97-208 required to bind necessary binding region required to bind deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain Flag-tag Flag-tag flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged c-term range C-terminal range c-term range c-term range C-terminal range c-term range human Homo sapiens Human physical association physical association b7ui21_eco27-fadd-6 1 22 enzyme target enzyme target substrate substrate unspecified role unspecified role ecolx Escherichia coli 27 enzyme enzyme unspecified role unspecified role B7UI21:p.[Asp221Ala;Asp223Ala] D221A/D223A mutation disrupting rate mutation disrupting interaction rate mutation disrupting rate alanine scanning alanine scanning certain certain sequence position certain certain certain sequence position certain D A certain certain sequence position certain certain certain sequence position certain D A This feature has been corrected as a result of our quality control procedures. The original label was 'D221A/D223A'. Wed May 02 16:51:24 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'asp221ala,asp223ala' Tue Jun 30 18:20:32 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.[Asp221Ala;Asp223Ala]' ecolx Escherichia coli glycosylation glycosylation reaction glycosylation b7ui21_eco27-fadd-7 16 22 unspecified role unspecified role prey prey Flag-tag Flag-tag flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged c-term range C-terminal range c-term range c-term range C-terminal range c-term range human Homo sapiens Human 27 unspecified role unspecified role bait bait HA-tag HA-tag ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range human Homo sapiens Human physical association physical association