DIP Database of Interacting Proteins 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ dip@mbi.ucla.edu Molecular composition and ultrastructure of the caveolar coat complex. Molecular composition and ultrastructure of the caveolar coat complex. PLoS biology 2012 imex curation Ludwig A., Howard G., Mendoza-Topaz C., Deerinck T., Mackey M., Sandin S., Ellisman MH., Nichols BJ. Only protein-protein interactions human Homo sapiens Human anti tag coip anti tag coimmunoprecipitation anti tag coip de novo protein sequence de novo protein sequencing by mass spectrometry de novo protein sequence Ludwig A., Howard G., Mendoza-Topaz C., Deerinck T., Mackey M., Sandin S., Ellisman MH., Nichols BJ. DIP original experiment: DIP-254686X PLoS biology 2012 IMEx Molecular composition and ultrastructure of the caveolar coat complex. Molecular composition and ultrastructure of the caveolar coat complex. Molecular composition and ultrastructure of the caveolar coat complex. PLoS biology 2012 imex curation Ludwig A., Howard G., Mendoza-Topaz C., Deerinck T., Mackey M., Sandin S., Ellisman MH., Nichols BJ. Only protein-protein interactions human Homo sapiens Human anti tag coip anti tag coimmunoprecipitation anti tag coip anti tag western anti tag western blot anti tag western Ludwig A., Howard G., Mendoza-Topaz C., Deerinck T., Mackey M., Sandin S., Ellisman MH., Nichols BJ. DIP original experiment: DIP-254693X PLoS biology 2012 IMEx Molecular composition and ultrastructure of the caveolar coat complex. Molecular composition and ultrastructure of the caveolar coat complex. Molecular composition and ultrastructure of the caveolar coat complex. PLoS biology 2012 imex curation Ludwig A., Howard G., Mendoza-Topaz C., Deerinck T., Mackey M., Sandin S., Ellisman MH., Nichols BJ. Only protein-protein interactions human Homo sapiens Human anti tag coip anti tag coimmunoprecipitation anti tag coip western blot western blot Immuno blot Immuno blot Ludwig A., Howard G., Mendoza-Topaz C., Deerinck T., Mackey M., Sandin S., Ellisman MH., Nichols BJ. DIP original experiment: DIP-254700X PLoS biology 2012 IMEx Molecular composition and ultrastructure of the caveolar coat complex. Molecular composition and ultrastructure of the caveolar coat complex. Molecular composition and ultrastructure of the caveolar coat complex. PLoS biology 2012 imex curation Ludwig A., Howard G., Mendoza-Topaz C., Deerinck T., Mackey M., Sandin S., Ellisman MH., Nichols BJ. Only protein-protein interactions mouse Mus musculus Mouse anti tag coip anti tag coimmunoprecipitation anti tag coip western blot western blot Immuno blot Immuno blot Ludwig A., Howard G., Mendoza-Topaz C., Deerinck T., Mackey M., Sandin S., Ellisman MH., Nichols BJ. DIP original experiment: DIP-254705X PLoS biology 2012 IMEx Molecular composition and ultrastructure of the caveolar coat complex. Molecular composition and ultrastructure of the caveolar coat complex. Molecular composition and ultrastructure of the caveolar coat complex. PLoS biology 2012 imex curation Ludwig A., Howard G., Mendoza-Topaz C., Deerinck T., Mackey M., Sandin S., Ellisman MH., Nichols BJ. Only protein-protein interactions human Homo sapiens Human anti tag coip anti tag coimmunoprecipitation anti tag coip predetermined predetermined participant predetermined Ludwig A., Howard G., Mendoza-Topaz C., Deerinck T., Mackey M., Sandin S., Ellisman MH., Nichols BJ. DIP original experiment: DIP-254702X PLoS biology 2012 IMEx Molecular composition and ultrastructure of the caveolar coat complex. Molecular composition and ultrastructure of the caveolar coat complex. Molecular composition and ultrastructure of the caveolar coat complex. PLoS biology 2012 imex curation Ludwig A., Howard G., Mendoza-Topaz C., Deerinck T., Mackey M., Sandin S., Ellisman MH., Nichols BJ. Only protein-protein interactions mouse Mus musculus Mouse anti tag coip anti tag coimmunoprecipitation anti tag coip western blot western blot Immuno blot Immuno blot Ludwig A., Howard G., Mendoza-Topaz C., Deerinck T., Mackey M., Sandin S., Ellisman MH., Nichols BJ. DIP original experiment: DIP-254706X PLoS biology 2012 IMEx Molecular composition and ultrastructure of the caveolar coat complex. Molecular composition and ultrastructure of the caveolar coat complex. Molecular composition and ultrastructure of the caveolar coat complex. PLoS biology 2012 imex curation Ludwig A., Howard G., Mendoza-Topaz C., Deerinck T., Mackey M., Sandin S., Ellisman MH., Nichols BJ. Only protein-protein interactions human Homo sapiens Human anti tag coip anti tag coimmunoprecipitation anti tag coip predetermined predetermined participant predetermined Ludwig A., Howard G., Mendoza-Topaz C., Deerinck T., Mackey M., Sandin S., Ellisman MH., Nichols BJ. DIP original experiment: DIP-254703X PLoS biology 2012 IMEx Molecular composition and ultrastructure of the caveolar coat complex. Molecular composition and ultrastructure of the caveolar coat complex. Molecular composition and ultrastructure of the caveolar coat complex. PLoS biology 2012 imex curation Ludwig A., Howard G., Mendoza-Topaz C., Deerinck T., Mackey M., Sandin S., Ellisman MH., Nichols BJ. Only protein-protein interactions mouse Mus musculus Mouse anti tag coip anti tag coimmunoprecipitation anti tag coip anti tag western anti tag western blot anti tag western Ludwig A., Howard G., Mendoza-Topaz C., Deerinck T., Mackey M., Sandin S., Ellisman MH., Nichols BJ. DIP original experiment: DIP-254709X PLoS biology 2012 IMEx Molecular composition and ultrastructure of the caveolar coat complex. Molecular composition and ultrastructure of the caveolar coat complex. Molecular composition and ultrastructure of the caveolar coat complex. PLoS biology 2012 imex curation Ludwig A., Howard G., Mendoza-Topaz C., Deerinck T., Mackey M., Sandin S., Ellisman MH., Nichols BJ. Only protein-protein interactions human Homo sapiens Human anti tag coip anti tag coimmunoprecipitation anti tag coip predetermined predetermined participant predetermined Ludwig A., Howard G., Mendoza-Topaz C., Deerinck T., Mackey M., Sandin S., Ellisman MH., Nichols BJ. DIP original experiment: DIP-254696X PLoS biology 2012 IMEx Molecular composition and ultrastructure of the caveolar coat complex. Molecular composition and ultrastructure of the caveolar coat complex. Molecular composition and ultrastructure of the caveolar coat complex. PLoS biology 2012 imex curation Ludwig A., Howard G., Mendoza-Topaz C., Deerinck T., Mackey M., Sandin S., Ellisman MH., Nichols BJ. Only protein-protein interactions human Homo sapiens Human anti tag coip anti tag coimmunoprecipitation anti tag coip de novo protein sequence de novo protein sequencing by mass spectrometry de novo protein sequence Ludwig A., Howard G., Mendoza-Topaz C., Deerinck T., Mackey M., Sandin S., Ellisman MH., Nichols BJ. DIP original experiment: DIP-254691X PLoS biology 2012 IMEx Molecular composition and ultrastructure of the caveolar coat complex. Molecular composition and ultrastructure of the caveolar coat complex. Molecular composition and ultrastructure of the caveolar coat complex. PLoS biology 2012 imex curation Ludwig A., Howard G., Mendoza-Topaz C., Deerinck T., Mackey M., Sandin S., Ellisman MH., Nichols BJ. Only protein-protein interactions human Homo sapiens Human anti tag coip anti tag coimmunoprecipitation anti tag coip predetermined predetermined participant predetermined Ludwig A., Howard G., Mendoza-Topaz C., Deerinck T., Mackey M., Sandin S., Ellisman MH., Nichols BJ. DIP original experiment: DIP-254701X PLoS biology 2012 IMEx Molecular composition and ultrastructure of the caveolar coat complex. Molecular composition and ultrastructure of the caveolar coat complex. Molecular composition and ultrastructure of the caveolar coat complex. PLoS biology 2012 imex curation Ludwig A., Howard G., Mendoza-Topaz C., Deerinck T., Mackey M., Sandin S., Ellisman MH., Nichols BJ. Only protein-protein interactions human Homo sapiens Human anti tag coip anti tag coimmunoprecipitation anti tag coip predetermined predetermined participant predetermined Ludwig A., Howard G., Mendoza-Topaz C., Deerinck T., Mackey M., Sandin S., Ellisman MH., Nichols BJ. DIP original experiment: DIP-254695X PLoS biology 2012 IMEx Molecular composition and ultrastructure of the caveolar coat complex. Molecular composition and ultrastructure of the caveolar coat complex. Molecular composition and ultrastructure of the caveolar coat complex. PLoS biology 2012 imex curation Ludwig A., Howard G., Mendoza-Topaz C., Deerinck T., Mackey M., Sandin S., Ellisman MH., Nichols BJ. Only protein-protein interactions human Homo sapiens Human anti tag coip anti tag coimmunoprecipitation anti tag coip anti tag western anti tag western blot anti tag western Ludwig A., Howard G., Mendoza-Topaz C., Deerinck T., Mackey M., Sandin S., Ellisman MH., Nichols BJ. DIP original experiment: DIP-254698X PLoS biology 2012 IMEx Molecular composition and ultrastructure of the caveolar coat complex. Molecular composition and ultrastructure of the caveolar coat complex. Molecular composition and ultrastructure of the caveolar coat complex. PLoS biology 2012 imex curation Ludwig A., Howard G., Mendoza-Topaz C., Deerinck T., Mackey M., Sandin S., Ellisman MH., Nichols BJ. Only protein-protein interactions mouse Mus musculus Mouse anti tag coip anti tag coimmunoprecipitation anti tag coip western blot western blot Immuno blot Immuno blot Ludwig A., Howard G., Mendoza-Topaz C., Deerinck T., Mackey M., Sandin S., Ellisman MH., Nichols BJ. DIP original experiment: DIP-254707X PLoS biology 2012 IMEx Molecular composition and ultrastructure of the caveolar coat complex. Molecular composition and ultrastructure of the caveolar coat complex. Molecular composition and ultrastructure of the caveolar coat complex. PLoS biology 2012 imex curation Ludwig A., Howard G., Mendoza-Topaz C., Deerinck T., Mackey M., Sandin S., Ellisman MH., Nichols BJ. Only protein-protein interactions human Homo sapiens Human anti tag coip anti tag coimmunoprecipitation anti tag coip de novo protein sequence de novo protein sequencing by mass spectrometry de novo protein sequence Ludwig A., Howard G., Mendoza-Topaz C., Deerinck T., Mackey M., Sandin S., Ellisman MH., Nichols BJ. DIP original experiment: DIP-254688X PLoS biology 2012 IMEx Molecular composition and ultrastructure of the caveolar coat complex. Molecular composition and ultrastructure of the caveolar coat complex. Molecular composition and ultrastructure of the caveolar coat complex. PLoS biology 2012 imex curation Ludwig A., Howard G., Mendoza-Topaz C., Deerinck T., Mackey M., Sandin S., Ellisman MH., Nichols BJ. Only protein-protein interactions human Homo sapiens Human anti tag coip anti tag coimmunoprecipitation anti tag coip anti tag western anti tag western blot anti tag western Ludwig A., Howard G., Mendoza-Topaz C., Deerinck T., Mackey M., Sandin S., Ellisman MH., Nichols BJ. DIP original experiment: DIP-254692X PLoS biology 2012 IMEx Molecular composition and ultrastructure of the caveolar coat complex. Molecular composition and ultrastructure of the caveolar coat complex. Molecular composition and ultrastructure of the caveolar coat complex. PLoS biology 2012 imex curation Ludwig A., Howard G., Mendoza-Topaz C., Deerinck T., Mackey M., Sandin S., Ellisman MH., Nichols BJ. Only protein-protein interactions human Homo sapiens Human anti tag coip anti tag coimmunoprecipitation anti tag coip western blot western blot Immuno blot Immuno blot Ludwig A., Howard G., Mendoza-Topaz C., Deerinck T., Mackey M., Sandin S., Ellisman MH., Nichols BJ. DIP original experiment: DIP-254704X PLoS biology 2012 IMEx Molecular composition and ultrastructure of the caveolar coat complex. Molecular composition and ultrastructure of the caveolar coat complex. Molecular composition and ultrastructure of the caveolar coat complex. PLoS biology 2012 imex curation Ludwig A., Howard G., Mendoza-Topaz C., Deerinck T., Mackey M., Sandin S., Ellisman MH., Nichols BJ. Only protein-protein interactions human Homo sapiens Human anti tag coip anti tag coimmunoprecipitation anti tag coip western blot western blot Immuno blot Immuno blot Ludwig A., Howard G., Mendoza-Topaz C., Deerinck T., Mackey M., Sandin S., Ellisman MH., Nichols BJ. DIP original experiment: DIP-254687X PLoS biology 2012 IMEx Molecular composition and ultrastructure of the caveolar coat complex. Molecular composition and ultrastructure of the caveolar coat complex. Molecular composition and ultrastructure of the caveolar coat complex. PLoS biology 2012 imex curation Ludwig A., Howard G., Mendoza-Topaz C., Deerinck T., Mackey M., Sandin S., Ellisman MH., Nichols BJ. Only protein-protein interactions human Homo sapiens Human anti tag coip anti tag coimmunoprecipitation anti tag coip de novo protein sequence de novo protein sequencing by mass spectrometry de novo protein sequence Ludwig A., Howard G., Mendoza-Topaz C., Deerinck T., Mackey M., Sandin S., Ellisman MH., Nichols BJ. DIP original experiment: DIP-254689X PLoS biology 2012 IMEx Molecular composition and ultrastructure of the caveolar coat complex. Molecular composition and ultrastructure of the caveolar coat complex. Molecular composition and ultrastructure of the caveolar coat complex. PLoS biology 2012 imex curation Ludwig A., Howard G., Mendoza-Topaz C., Deerinck T., Mackey M., Sandin S., Ellisman MH., Nichols BJ. Only protein-protein interactions human Homo sapiens Human anti tag coip anti tag coimmunoprecipitation anti tag coip de novo protein sequence de novo protein sequencing by mass spectrometry de novo protein sequence Ludwig A., Howard G., Mendoza-Topaz C., Deerinck T., Mackey M., Sandin S., Ellisman MH., Nichols BJ. DIP original experiment: DIP-254690X PLoS biology 2012 IMEx Molecular composition and ultrastructure of the caveolar coat complex. Molecular composition and ultrastructure of the caveolar coat complex. Molecular composition and ultrastructure of the caveolar coat complex. PLoS biology 2012 imex curation Ludwig A., Howard G., Mendoza-Topaz C., Deerinck T., Mackey M., Sandin S., Ellisman MH., Nichols BJ. Only protein-protein interactions human Homo sapiens Human anti tag coip anti tag coimmunoprecipitation anti tag coip western blot western blot Immuno blot Immuno blot Ludwig A., Howard G., Mendoza-Topaz C., Deerinck T., Mackey M., Sandin S., Ellisman MH., Nichols BJ. DIP original experiment: DIP-254697X PLoS biology 2012 IMEx Molecular composition and ultrastructure of the caveolar coat complex. Molecular composition and ultrastructure of the caveolar coat complex. Molecular composition and ultrastructure of the caveolar coat complex. PLoS biology 2012 imex curation Ludwig A., Howard G., Mendoza-Topaz C., Deerinck T., Mackey M., Sandin S., Ellisman MH., Nichols BJ. Only protein-protein interactions mouse Mus musculus Mouse anti tag coip anti tag coimmunoprecipitation anti tag coip western blot western blot Immuno blot Immuno blot Ludwig A., Howard G., Mendoza-Topaz C., Deerinck T., Mackey M., Sandin S., Ellisman MH., Nichols BJ. DIP original experiment: DIP-254708X PLoS biology 2012 IMEx Molecular composition and ultrastructure of the caveolar coat complex. Molecular composition and ultrastructure of the caveolar coat complex. Molecular composition and ultrastructure of the caveolar coat complex. PLoS biology 2012 imex curation Ludwig A., Howard G., Mendoza-Topaz C., Deerinck T., Mackey M., Sandin S., Ellisman MH., Nichols BJ. Only protein-protein interactions human Homo sapiens Human anti tag coip anti tag coimmunoprecipitation anti tag coip anti tag western anti tag western blot anti tag western Ludwig A., Howard G., Mendoza-Topaz C., Deerinck T., Mackey M., Sandin S., Ellisman MH., Nichols BJ. DIP original experiment: DIP-254699X PLoS biology 2012 IMEx Molecular composition and ultrastructure of the caveolar coat complex. Molecular composition and ultrastructure of the caveolar coat complex. Molecular composition and ultrastructure of the caveolar coat complex. PLoS biology 2012 imex curation Ludwig A., Howard G., Mendoza-Topaz C., Deerinck T., Mackey M., Sandin S., Ellisman MH., Nichols BJ. Only protein-protein interactions human Homo sapiens Human anti tag coip anti tag coimmunoprecipitation anti tag coip western blot western blot Immuno blot Immuno blot Ludwig A., Howard G., Mendoza-Topaz C., Deerinck T., Mackey M., Sandin S., Ellisman MH., Nichols BJ. DIP original experiment: DIP-254694X PLoS biology 2012 IMEx Molecular composition and ultrastructure of the caveolar coat complex. cav1_mouse Caveolin-1 Cav1 Cav protein protein mouse Mus musculus Mouse MSGGKYVDSEGHLYTVPIREQGNIYKPNNKAMADEVTEKQVYDAHTKEIDLVNRDPKHLNDDVVKIDFEDVIAEPEGTHSFDGIWKASFTTFTVTKYWFYRLLSTIFGIPMALIWGIYFAILSFLHIWAVVPCIKSFLIEIQCISRVYSIYVHTFCDPLFEAIGKIFSNIRISTQKEI DIP protein P49817 original sequence version: 94 DIP protein P49817 original sequence version: 143 DIP protein P49817 original sequence version: 168 CF88FE9B1D3D67AE cavn2_human Caveolae-associated protein 2 CAVIN2 Cavin-2 PS-p68 Phosphatidylserine-binding protein SDPR Serum deprivation-response protein protein protein human Homo sapiens Human MGEDAAQAEKFQHPGSDMRQEKPSSPSPMPSSTPSPSLNLGNTEEAIRDNSQVNAVTVLTLLDKLVNMLDAVQENQHKMEQRQISLEGSVKGIQNDLTKLSKYQASTSNTVSKLLEKSRKVSAHTRAVKERMDRQCAQVKRLENNHAQLLRRNHFKVLIFQEENEIPASVFVKQPVSGAVEGKEELPDENKSLEETLHTVDLSSDDDLPHDEEALEDSAEEKVEESRAEKIKRSSLKKVDSLKKAFSRQNIEKKMNKLGTKIVSVERREKIKKSLTSNHQKISSGKSSPFKVSPLTFGRKKVREGESHAENETKSEDLPSSEQMPNDQEEESFAEGHSEASLASALVEGEIAEEAAEKATSRGSNSGMDSNIDLTIVEDEEEESVALEQAQKVRYEGSYALTSEEAERSDGDPVQPAVLQVHQTS DIP protein O95810 original sequence version: 91 0631CBF4BED537F9 cav2_human Caveolin-2 CAV2 protein protein human Homo sapiens Human MGLETEKADVQLFMDDDSYSHHSGLEYADPEKFADSDQDRDPHRLNSHLKLGFEDVIAEPVTTHSFDKVWICSHALFEISKYVMYKFLTVFLAIPLAFIAGILFATLSCLHIWILMPFVKTCLMVLPSVQTIWKSVTDVIIAPLCTSVGRCFSSVSLQLSQD DIP protein P51636 original sequence version: 131 89FDEDA861330B87 cavn1_human Caveolae-associated protein 1 CAVIN1 Cavin-1 PTRF Polymerase I and transcript release factor FKSG13 protein protein human Homo sapiens Human MEDPTLYIVERPLPGYPDAEAPEPSSAGAQAAEEPSGAGSEELIKSDQVNGVLVLSLLDKIIGAVDQIQLTQAQLEERQAEMEGAVQSIQGELSKLGKAHATTSNTVSKLLEKVRKVSVNVKTVRGSLERQAGQIKKLEVNEAELLRRRNFKVMIYQDEVKLPAKLSISKSLKESEALPEKEGEELGEGERPEEDAAALELSSDEAVEVEEVIEESRAERIKRSGLRRVDDFKKAFSKEKMEKTKVRTRENLEKTRLKTKENLEKTRHTLEKRMNKLGTRLVPAERREKLKTSRDKLRKSFTPDHVVYARSKTAVYKVPPFTFHVKKIREGQVEVLKATEMVEVGADDDEGGAERGEAGDLRRGSSPDVHALLEITEESDAVLVDKSDSD DIP protein Q6NZI2 original sequence version: 70 DIP protein Q6NZI2 original sequence version: 100 E37945A9C9E819D4 cavn3_human Caveolae-associated protein 3 CAVIN3 Cavin-3 PRKCDBP Protein kinase C delta-binding protein SRBC Serum deprivation response factor-related gene product that binds to C-kinase protein protein human Homo sapiens Human MRESALERGPVPEAPAGGPVHAVTVVTLLEKLASMLETLRERQGGLARRQGGLAGSVRRIQSGLGALSRSHDTTSNTLAQLLAKAERVSSHANAAQERAVRRAAQVQRLEANHGLLVARGKLHVLLFKEEGEVPASAFQKAPEPLGPADQSELGPEQLEAEVGESSDEEPVESRAQRLRRTGLQKVQSLRRALSGRKGPAAPPPTPVKPPRLGPGRSAEAQPEAQPALEPTLEPEPPQDTEEDPGRPGAAEEALLQMESVA DIP protein Q969G5 original sequence version: 76 cav1_human Caveolin-1 CAV1 CAV protein protein human Homo sapiens Human MSGGKYVDSEGHLYTVPIREQGNIYKPNNKAMADELSEKQVYDAHTKEIDLVNRDPKHLNDDVVKIDFEDVIAEPEGTHSFDGIWKASFTTFTVTKYWFYRLLSALFGIPMALIWGIYFAILSFLHIWAVVPCIKSFLIEIQCISRVYSIYVHTVCDPLFEAVGKIFSNVRINLQKEI DIP protein Q03135 original sequence version: 164 DIP protein Q03135 original sequence version: 119 DIP protein Q03135 original sequence version: 122 DIP protein Q03135-1 original sequence version: 122 DIP protein Q03135 original sequence version: 133 DIP protein Q03135 original sequence version: 155 DIP protein Q03135 original sequence version: 147 2424DE9B5E6521D5 cavn1_mouse Caveolae-associated protein 1 Cavin1 Cav-p60 Cavin-1 Polymerase I and transcript release factor Ptrf protein protein mouse Mus musculus Mouse MEDVTLHIVERPYSGFPDASSEGPEPTQGEARATEEPSGTGSDELIKSDQVNGVLVLSLLDKIIGAVDQIQLTQAQLEERQAEMEGAVQSIQGELSKLGKAHATTSNTVSKLLEKVRKVSVNVKTVRGSLERQAGQIKKLEVNEAELLRRRNFKVMIYQDEVKLPAKLSVSKSLKESEALPEKEGDELGEGERPEDDTAAIELSSDEAVEVEEVIEESRAERIKRSGLRRVDDFKKAFSKEKMEKTKVRTRENLEKTRLKTKENLEKTRHTLEKRMNKLGTRLVPVERREKLKTSRDKLRKSFTPDHVVYARSKTAVYKVPPFTFHVKKIREGEVEVLKATEMVEVGPEDDEVGAERGEATDLLRGSSPDVHTLLEITEESDAVLVDKSDSD DIP protein O54724 original sequence version: 95 6871CBC06DCF5C35 prkcdbp-ptrf-3 11 29 unspecified role unspecified role bait bait GFP-tag GFP-tag gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range human Homo sapiens Human 28 unspecified role unspecified role prey prey human Homo sapiens Human physical association physical association cav1-cav2-1 1 29 unspecified role unspecified role prey prey human Homo sapiens Human 26 unspecified role unspecified role prey prey human Homo sapiens Human 28 unspecified role unspecified role prey prey human Homo sapiens Human 27 unspecified role unspecified role prey prey human Homo sapiens Human 30 unspecified role unspecified role bait bait GFP-tag GFP-tag gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range human Homo sapiens Human association association ptrf-cav1-1 19 29 unspecified role unspecified role prey prey human Homo sapiens Human 26 unspecified role unspecified role prey prey human Homo sapiens Human 28 unspecified role unspecified role bait bait GFP-tag GFP-tag gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range human Homo sapiens Human 30 unspecified role unspecified role prey prey human Homo sapiens Human association association ptrf-prkcdbp-1 22 29 unspecified role unspecified role prey prey mCherry-tag mCherry-tag mcherry mcherry fluorescent protein tag mcherry c-term range C-terminal range c-term range c-term range C-terminal range c-term range mouse Mus musculus Mouse 31 unspecified role unspecified role prey prey mouse Mus musculus Mouse 28 unspecified role unspecified role bait bait GFP-tag GFP-tag gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range mouse Mus musculus Mouse association association sdpr-ptrf-1 9 26 unspecified role unspecified role bait bait GFP-tag GFP-tag gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range human Homo sapiens Human 28 unspecified role unspecified role prey prey human Homo sapiens Human physical association physical association sdpr-cav1-1 16 26 unspecified role unspecified role bait bait GFP-tag GFP-tag gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range human Homo sapiens Human 28 unspecified role unspecified role prey prey human Homo sapiens Human 30 unspecified role unspecified role prey prey human Homo sapiens Human association association ptrf-cav1-2 5 28 unspecified role unspecified role bait bait GFP-tag GFP-tag gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range human Homo sapiens Human 30 unspecified role unspecified role prey prey human Homo sapiens Human physical association physical association cav1-ptrf-7 3 28 unspecified role unspecified role prey prey human Homo sapiens Human 30 unspecified role unspecified role bait bait GFP-tag GFP-tag gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range human Homo sapiens Human physical association physical association sdpr-cav1-2 20 29 unspecified role unspecified role prey prey human Homo sapiens Human 26 unspecified role unspecified role bait bait GFP-tag GFP-tag gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range human Homo sapiens Human 28 unspecified role unspecified role prey prey human Homo sapiens Human 30 unspecified role unspecified role prey prey human Homo sapiens Human association association ptrf-ptrf-3 21 28 unspecified role unspecified role prey prey human Homo sapiens Human 28 unspecified role unspecified role bait bait GFP-tag GFP-tag gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range human Homo sapiens Human physical association physical association ptrf-cav1-3 4 25 unspecified role unspecified role prey prey mouse Mus musculus Mouse 31 unspecified role unspecified role prey prey mouse Mus musculus Mouse 26 unspecified role unspecified role prey prey mCherry-tag mCherry-tag mcherry mcherry fluorescent protein tag mcherry c-term range C-terminal range c-term range c-term range C-terminal range c-term range mouse Mus musculus Mouse 28 unspecified role unspecified role bait bait GFP-tag GFP-tag gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range mouse Mus musculus Mouse association association prkcdbp-cav1-1 2 29 unspecified role unspecified role bait bait GFP-tag GFP-tag gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range human Homo sapiens Human 28 unspecified role unspecified role prey prey human Homo sapiens Human 30 unspecified role unspecified role prey prey human Homo sapiens Human association association cav1-ptrf-8 18 28 unspecified role unspecified role prey prey human Homo sapiens Human 30 unspecified role unspecified role bait bait GFP-tag GFP-tag gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range human Homo sapiens Human physical association physical association cav1-prkcdbp-3 15 29 unspecified role unspecified role prey prey human Homo sapiens Human 26 unspecified role unspecified role prey prey human Homo sapiens Human 28 unspecified role unspecified role prey prey human Homo sapiens Human 30 unspecified role unspecified role bait bait GFP-tag GFP-tag gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range human Homo sapiens Human association association prkcdbp-cav1-2 10 29 unspecified role unspecified role bait bait GFP-tag GFP-tag gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range human Homo sapiens Human 26 unspecified role unspecified role prey prey human Homo sapiens Human 28 unspecified role unspecified role prey prey human Homo sapiens Human 30 unspecified role unspecified role prey prey human Homo sapiens Human association association cav1-prkcdbp-4 17 29 unspecified role unspecified role prey prey human Homo sapiens Human 28 unspecified role unspecified role prey prey human Homo sapiens Human 30 unspecified role unspecified role bait bait GFP-tag GFP-tag gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range human Homo sapiens Human association association ptrf-cav1-4 24 28 unspecified role unspecified role prey prey human Homo sapiens Human 28 unspecified role unspecified role bait bait GFP-tag GFP-tag gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range human Homo sapiens Human 30 unspecified role unspecified role prey prey human Homo sapiens Human association association prkcdbp-cav1-3 13 29 unspecified role unspecified role bait bait GFP-tag GFP-tag gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range human Homo sapiens Human 28 unspecified role unspecified role prey prey human Homo sapiens Human 30 unspecified role unspecified role prey prey human Homo sapiens Human association association ptrf-cav1-5 14 29 unspecified role unspecified role prey prey mCherry-tag mCherry-tag mcherry mcherry fluorescent protein tag mcherry c-term range C-terminal range c-term range c-term range C-terminal range c-term range mouse Mus musculus Mouse 25 unspecified role unspecified role prey prey mouse Mus musculus Mouse 31 unspecified role unspecified role prey prey mouse Mus musculus Mouse 28 unspecified role unspecified role bait bait GFP-tag GFP-tag gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range mouse Mus musculus Mouse association association ptrf-ptrf-4 6 31 unspecified role unspecified role prey prey mouse Mus musculus Mouse 26 unspecified role unspecified role prey prey mCherry-tag mCherry-tag mcherry mcherry fluorescent protein tag mcherry c-term range C-terminal range c-term range c-term range C-terminal range c-term range mouse Mus musculus Mouse 28 unspecified role unspecified role bait bait GFP-tag GFP-tag gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range mouse Mus musculus Mouse association association sdpr-cav1-3 12 26 unspecified role unspecified role bait bait GFP-tag GFP-tag gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range human Homo sapiens Human 30 unspecified role unspecified role prey prey human Homo sapiens Human physical association physical association prkcdbp-ptrf-4 23 29 unspecified role unspecified role bait bait GFP-tag GFP-tag gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range human Homo sapiens Human 28 unspecified role unspecified role prey prey human Homo sapiens Human physical association physical association prkcdbp-cav1-4 7 29 unspecified role unspecified role bait bait GFP-tag GFP-tag gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range human Homo sapiens Human 30 unspecified role unspecified role prey prey human Homo sapiens Human physical association physical association sdpr-cav1-4 8 26 unspecified role unspecified role bait bait GFP-tag GFP-tag gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range mouse Mus musculus Mouse 29 unspecified role unspecified role prey prey mCherry-tag mCherry-tag mcherry mcherry fluorescent protein tag mcherry c-term range C-terminal range c-term range c-term range C-terminal range c-term range mouse Mus musculus Mouse 25 unspecified role unspecified role prey prey mouse Mus musculus Mouse 31 unspecified role unspecified role prey prey mouse Mus musculus Mouse association association