DIP Database of Interacting Proteins 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ dip@mbi.ucla.edu Crystal structure of MraY, an essential membrane enzyme for bacterial cell wall synthesis. Crystal structure of MraY, an essential membrane enzyme for bacterial cell wall synthesis. Science (New York, N.Y.) 2013 imex curation Chung BC., Zhao J., Gillespie RA., Kwon DY., Guan Z., Hong J., Zhou P., Lee SY. Only protein-protein interactions ecolx Escherichia coli crosslink cross-linking study crosslink weight by comassie molecular weight estimation by coomasie staining weight by comassie Chung BC., Zhao J., Gillespie RA., Kwon DY., Guan Z., Hong J., Zhou P., Lee SY. DIP original experiment: DIP-266818X Science (New York, N.Y.) 2013 IMEx Crystal structure of MraY, an essential membrane enzyme for bacterial cell wall synthesis. Crystal structure of MraY, an essential membrane enzyme for bacterial cell wall synthesis. Crystal structure of MraY, an essential membrane enzyme for bacterial cell wall synthesis. Science (New York, N.Y.) 2013 imex curation Chung BC., Zhao J., Gillespie RA., Kwon DY., Guan Z., Hong J., Zhou P., Lee SY. Only protein-protein interactions ecolx Escherichia coli crosslink cross-linking study crosslink anti tag western anti tag western blot anti tag western Chung BC., Zhao J., Gillespie RA., Kwon DY., Guan Z., Hong J., Zhou P., Lee SY. DIP original experiment: DIP-266819X Science (New York, N.Y.) 2013 IMEx Crystal structure of MraY, an essential membrane enzyme for bacterial cell wall synthesis. Crystal structure of MraY, an essential membrane enzyme for bacterial cell wall synthesis. Crystal structure of MraY, an essential membrane enzyme for bacterial cell wall synthesis. Science (New York, N.Y.) 2013 imex curation Chung BC., Zhao J., Gillespie RA., Kwon DY., Guan Z., Hong J., Zhou P., Lee SY. Only protein-protein interactions ecolx Escherichia coli crosslink cross-linking study crosslink anti tag western anti tag western blot anti tag western Chung BC., Zhao J., Gillespie RA., Kwon DY., Guan Z., Hong J., Zhou P., Lee SY. DIP original experiment: DIP-266820X Science (New York, N.Y.) 2013 IMEx Crystal structure of MraY, an essential membrane enzyme for bacterial cell wall synthesis. Crystal structure of MraY, an essential membrane enzyme for bacterial cell wall synthesis. Crystal structure of MraY, an essential membrane enzyme for bacterial cell wall synthesis. Science (New York, N.Y.) 2013 imex curation Chung BC., Zhao J., Gillespie RA., Kwon DY., Guan Z., Hong J., Zhou P., Lee SY. Only protein-protein interactions ecolx Escherichia coli x-ray diffraction x-ray crystallography X-ray X-ray x-ray diffraction predetermined predetermined participant predetermined Chung BC., Zhao J., Gillespie RA., Kwon DY., Guan Z., Hong J., Zhou P., Lee SY. DIP original experiment: DIP-266817X Science (New York, N.Y.) 2013 IMEx Crystal structure of MraY, an essential membrane enzyme for bacterial cell wall synthesis. mray_aquae Phospho-N-acetylmuramoyl-pentapeptide-transferase mraY UDP-MurNAc-pentapeptide phosphotransferase aq_053 protein protein aquae Aquifex aeolicus (strain VF5) MLYQLALLLKDYWFAFNVLKYITFRSFTAVLIAFFLTLVLSPSFINRLRKIQRLFGGYVREYTPESHEVKKYTPTMGGIVILIVVTLSTLLLMRWDIKYTWVVLLSFLSFGTIGFWDDYVKLKNKKGISIKTKFLLQVLSASLISVLIYYWADIDTILYFPFFKELYVDLGVLYLPFAVFVIVGSANAVNLTDGLDGLAIGPAMTTATALGVVAYAVGHSKIAQYLNIPYVPYAGELTVFCFALVGAGLGFLWFNSFPAQMFMGDVGSLSIGASLATVALLTKSEFIFAVAAGVFVFETISVILQIIYFRWTGGKRLFKRAPFHHHLELNGLPEPKIVVRMWIISILLAIIAISMLKLR DIP protein O66465 original sequence version: 107 DIP protein O66465 original sequence version: 111 mray-1 4 5 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli direct interaction direct interaction mray-2 1 5 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli direct interaction direct interaction mray-3 2 5 unspecified role unspecified role unspecified role unspecified role O66465:p.[Thr23Cys;Ser354Cys] T23C/S354C mutation mutation certain certain sequence position certain certain certain sequence position certain S C certain certain sequence position certain certain certain sequence position certain T C This feature has been corrected as a result of our quality control procedures. The original label was 'T23C/S354C'. Wed May 02 14:37:30 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'thr23cys,ser354cys' Tue Jun 30 19:54:34 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.[Thr23Cys;Ser354Cys]' His-tag His-tag his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range ecolx Escherichia coli direct interaction direct interaction mray-4 3 5 unspecified role unspecified role unspecified role unspecified role O66465:p.[Trp253Cys;Arg340Cys] W253C/R340C mutation mutation certain certain sequence position certain certain certain sequence position certain R C certain certain sequence position certain certain certain sequence position certain W C This feature has been corrected as a result of our quality control procedures. The original label was 'W253C/R340C'. Wed May 02 18:52:46 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'trp253cys,arg340cys' Tue Jun 30 17:29:08 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.[Trp253Cys;Arg340Cys]' His-tag His-tag his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range ecolx Escherichia coli direct interaction direct interaction