DIP Database of Interacting Proteins 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ dip@mbi.ucla.edu Conserved regulation of cardiac calcium uptake by peptides encoded in small open reading frames. Conserved regulation of cardiac calcium uptake by peptides encoded in small open reading frames. Science (New York, N.Y.) 2013 imex curation Magny EG., Pueyo JI., Pearl FM., Cespedes MA., Niven JE., Bishop SA., Couso JP. Only protein-protein interactions drome Drosophila melanogaster (Fruit fly) Fruit fly anti tag coip anti tag coimmunoprecipitation anti tag coip predetermined predetermined participant predetermined Magny EG., Pueyo JI., Pearl FM., Cespedes MA., Niven JE., Bishop SA., Couso JP. DIP original experiment: DIP-266815X Science (New York, N.Y.) 2013 IMEx Conserved regulation of cardiac calcium uptake by peptides encoded in small open reading frames. Conserved regulation of cardiac calcium uptake by peptides encoded in small open reading frames. Conserved regulation of cardiac calcium uptake by peptides encoded in small open reading frames. Science (New York, N.Y.) 2013 imex curation Magny EG., Pueyo JI., Pearl FM., Cespedes MA., Niven JE., Bishop SA., Couso JP. Only protein-protein interactions drome Drosophila melanogaster (Fruit fly) Fruit fly anti tag coip anti tag coimmunoprecipitation anti tag coip predetermined predetermined participant predetermined Magny EG., Pueyo JI., Pearl FM., Cespedes MA., Niven JE., Bishop SA., Couso JP. DIP original experiment: DIP-266814X Science (New York, N.Y.) 2013 IMEx Conserved regulation of cardiac calcium uptake by peptides encoded in small open reading frames. Conserved regulation of cardiac calcium uptake by peptides encoded in small open reading frames. Conserved regulation of cardiac calcium uptake by peptides encoded in small open reading frames. Science (New York, N.Y.) 2013 imex curation Magny EG., Pueyo JI., Pearl FM., Cespedes MA., Niven JE., Bishop SA., Couso JP. Only protein-protein interactions drome Drosophila melanogaster (Fruit fly) Fruit fly anti tag coip anti tag coimmunoprecipitation anti tag coip predetermined predetermined participant predetermined Magny EG., Pueyo JI., Pearl FM., Cespedes MA., Niven JE., Bishop SA., Couso JP. DIP original experiment: DIP-266816X Science (New York, N.Y.) 2013 IMEx Conserved regulation of cardiac calcium uptake by peptides encoded in small open reading frames. Conserved regulation of cardiac calcium uptake by peptides encoded in small open reading frames. Conserved regulation of cardiac calcium uptake by peptides encoded in small open reading frames. Science (New York, N.Y.) 2013 imex curation Magny EG., Pueyo JI., Pearl FM., Cespedes MA., Niven JE., Bishop SA., Couso JP. Only protein-protein interactions drome Drosophila melanogaster (Fruit fly) Fruit fly anti tag coip anti tag coimmunoprecipitation anti tag coip western blot western blot Immuno blot Immuno blot Magny EG., Pueyo JI., Pearl FM., Cespedes MA., Niven JE., Bishop SA., Couso JP. DIP original experiment: DIP-266813X Science (New York, N.Y.) 2013 IMEx Conserved regulation of cardiac calcium uptake by peptides encoded in small open reading frames. atc1_drome Calcium-transporting ATPase sarcoplasmic/endoplasmic reticulum type SERCA Ca-P60A Calcium ATPase at 60A Calcium pump Sarcoplasmic/endoplasmic reticulum Ca(2+)-ATPase CG3725 protein protein drome Drosophila melanogaster (Fruit fly) Fruit fly MEDGHSKTVEQSLNFFGTDPERGLTLDQIKANQKKYGPNELPTEEGKSIWQLVLEQFDDLLVKILLLAAIISFVLALFEEHEETFTAFVEPLVILLILIANAVVGVWQERNAESAIEALKEYEPEMGKVVRQDKSGIQKVRAKEIVPGDLVEVSVGDKIPADIRITHIYSTTLRIDQSILTGESVSVIKHTDAIPDPRAVNQDKKNILFSGTNVAAGKARGVVIGTGLSTAIGKIRTEMSETEEIKTPLQQKLDEFGEQLSKVISVICVAVWAINIGHFNDPAHGGSWIKGAIYYFKIAVALAVAAIPEGLPAVITTCLALGTRRMAKKNAIVRSLPSVETLGCTSVICSDKTGTLTTNQMSVSRMFIFDKVEGNDSSFLEFEMTGSTYEPIGEVFLNGQRIKAADYDTLQELSTICIMCNDSAIDYNEFKQAFEKVGEATETALIVLAEKLNSFSVNKSGLDRRSAAIACRGEIETKWKKEFTLEFSRDRKSMSSYCTPLKASRLGTGPKLFVKGAPEGVLERCTHARVGTTKVPLTSALKAKILALTGQYGTGRDTLRCLALAVADSPMKPDEMDLGDSTKFYQYEVNLTFVGVVGMLDPPRKEVFDSIVRCRAAGIRVIVITGDNKATAEAICRRIGVFAEDEDTTGKSYSGREFDDLSPTEQKAAVARSRLFSRVEPQHKSKIVEFLQSMNEISAMTGDGVNDAPALKKAEIGIAMGSGTAVAKSAAEMVLADDNFSSIVSAVEEGRAIYNNMKQFIRYLISSNIGEVVSIFLTAALGLPEALIPVQLLWVNLVTDGLPATALGFNPPDLDIMEKPPRKADEGLISGWLFFRYMAIGFYVGAATVGAAAWWFVFSDEGPKLSYWQLTHHLSCLGGGDEFKGVDCKIFSDPHAMTMALSVLVTIEMLNAMNSLSENQSLITMPPWCNLWLIGSMALSFTLHFVILYVDVLSTVFQVTPLSAEEWITVMKFSIPVVLLDETLKFVARKIADGESPIYKMHGIVLMWAVFFGLLYAMML DIP protein P22700 original sequence version: 153 6A62D350BF316984 slcb_drome Sarcolamban B SclB CG45091 protein protein drome Drosophila melanogaster (Fruit fly) Fruit fly MNEAKSLFTTFLILAFLLFLLYAFYEAAF DIP protein C0HJH3 original sequence version: 11 ppla_human Cardiac phospholamban PLN PLB protein protein human Homo sapiens Human MEKVQYLTRSAIRRASTIEMPQQARQKLQNLFINFCLILICLLLICIIVMLL DIP protein P26678 original sequence version: 151 0766304A76A854D3 sarco_human Sarcolipin SLN protein protein human Homo sapiens Human MGINTRELFLNFTIVLITVILMWLLVRSYQY DIP protein O00631 original sequence version: 110 9B245D9ACD26C58F slca_drome Sarcolamban A SclA CG45090 protein protein drome Drosophila melanogaster (Fruit fly) Fruit fly MSEARNLFTTFGILAILLFFLYLIYAVL DIP protein C0HJH4 original sequence version: 13 sln-ca_p60a-1 4 5 unspecified role unspecified role prey prey drome Drosophila melanogaster (Fruit fly) Fruit fly 8 unspecified role unspecified role bait bait Flag-tag Flag-tag flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged n-term range n-terminal range n-term range n-term range n-terminal range n-term range drome Drosophila melanogaster (Fruit fly) Fruit fly physical association physical association sclb-ca_p60a-1 3 6 unspecified role unspecified role bait bait Flag-tag Flag-tag flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged n-term range n-terminal range n-term range n-term range n-terminal range n-term range drome Drosophila melanogaster (Fruit fly) Fruit fly 5 unspecified role unspecified role prey prey drome Drosophila melanogaster (Fruit fly) Fruit fly physical association physical association pln-ca_p60a-1 2 7 unspecified role unspecified role bait bait Flag-tag Flag-tag flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged n-term range n-terminal range n-term range n-term range n-terminal range n-term range drome Drosophila melanogaster (Fruit fly) Fruit fly 5 unspecified role unspecified role prey prey drome Drosophila melanogaster (Fruit fly) Fruit fly physical association physical association scla-ca_p60a-1 1 9 unspecified role unspecified role bait bait Flag-tag Flag-tag flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged n-term range n-terminal range n-term range n-term range n-terminal range n-term range drome Drosophila melanogaster (Fruit fly) Fruit fly 5 unspecified role unspecified role prey prey drome Drosophila melanogaster (Fruit fly) Fruit fly physical association physical association