DIP Database of Interacting Proteins 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ dip@mbi.ucla.edu Sonic Hedgehog promotes tumor cell survival by inhibiting CDON pro-apoptotic activity. Sonic Hedgehog promotes tumor cell survival by inhibiting CDON pro-apoptotic activity. PLoS biology 2012 imex curation Delloye-Bourgeois C., Gibert B., Rama N., Delcros JG., Gadot N., Scoazec JY., Krauss R., Bernet A., Mehlen P. Only protein-protein interactions in vitro In vitro protease assay protease assay predetermined predetermined participant predetermined Delloye-Bourgeois C., Gibert B., Rama N., Delcros JG., Gadot N., Scoazec JY., Krauss R., Bernet A., Mehlen P. DIP original experiment: DIP-254667X PLoS biology 2012 IMEx Sonic Hedgehog promotes tumor cell survival by inhibiting CDON pro-apoptotic activity. Sonic Hedgehog promotes tumor cell survival by inhibiting CDON pro-apoptotic activity. Sonic Hedgehog promotes tumor cell survival by inhibiting CDON pro-apoptotic activity. PLoS biology 2012 imex curation Delloye-Bourgeois C., Gibert B., Rama N., Delcros JG., Gadot N., Scoazec JY., Krauss R., Bernet A., Mehlen P. Only protein-protein interactions human Homo sapiens Human anti bait coip anti bait coimmunoprecipitation anti bait coip anti tag western anti tag western blot anti tag western Delloye-Bourgeois C., Gibert B., Rama N., Delcros JG., Gadot N., Scoazec JY., Krauss R., Bernet A., Mehlen P. DIP original experiment: DIP-254668X PLoS biology 2012 IMEx Sonic Hedgehog promotes tumor cell survival by inhibiting CDON pro-apoptotic activity. Sonic Hedgehog promotes tumor cell survival by inhibiting CDON pro-apoptotic activity. Sonic Hedgehog promotes tumor cell survival by inhibiting CDON pro-apoptotic activity. PLoS biology 2012 imex curation Delloye-Bourgeois C., Gibert B., Rama N., Delcros JG., Gadot N., Scoazec JY., Krauss R., Bernet A., Mehlen P. Only protein-protein interactions mouse Mus musculus Mouse anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Delloye-Bourgeois C., Gibert B., Rama N., Delcros JG., Gadot N., Scoazec JY., Krauss R., Bernet A., Mehlen P. DIP original experiment: DIP-254666X PLoS biology 2012 IMEx Sonic Hedgehog promotes tumor cell survival by inhibiting CDON pro-apoptotic activity. cdon_mouse Cell adhesion molecule-related/down-regulated by oncogenes Cdon Cdo protein protein mouse Mus musculus Mouse MHPDLGPLWTLLYVLVILCSSVSSDLAPYFISEPLSAVQKLGRPVVLHCSAKPVTARISWLHNGKRLDRNTEQIKIHRGTLTILSLNPSLSGCYQCVANNSVGAVVSGPATVSAAALGDFDSSTMHVITAEEKNTGFIGCRVPESNPKAEVRYKIRGKWLKHSTGNYIILPSGNLQVLNVSSKDKGSYKCAAYNPVTSELKVEPTGRKLLVSRPSSNGFHILHPALSQALAVLPHSPVTLECVVSGVPASQVYWLKDGQDAVAGSNWRRLYSHLATASIDPADSGNYSCVVGNKSGDVKHVTYMVNVLEHASISKGLHDQKVSLGATVHFTCDVHGNPAPNRTWFHNAQPIHPSSRHLTEGNVLKITRVVMEDSGLYQCVADNGIGFMQSTGRLQIEQDSGWKPVIVTAPANIEVMDGDFVTLSCNATGVPVPVIHWYGRHGLITSHPSQVLRSKPRKSHLFRPGDLDLEPVYLIMSQAGSSSLSIQAVTLEHAGKYTCEATNKHGSTQSEAFLTVVPFETNTKAESVTPSEASQNDERDPQDGSESSLLNLFPVKVHPSGVELPAERNASVPDAPNILSPPQTHMPDTYNLVWRAGRDGGMPINAYFVKYRKLDDGSGAVGSWHTVRVPGSENELHLTELEPSSLYEVLMVARSAVGEGQPAMLTFRTSKEKMASSKNTQASFPPVGVPKRPVTAEASNSNFGVVLTDSSRHSGVPEAPDRPTISMASETSVYVTWIPRANGGSPITAFKVEYKRMRTSDWLVAAEDIPPSKLSVEVRSLEPGSIYKFRVIAINHYGESFRSSASRPYQVAGFPNRFSNRPITGPHIAYTEAVSDTQIMLKWTYVPSSNNNTPIQGFYIYYRPTDSDNDSDYKRDVVEGSKQWHTIGHLQPETSYDIKMQCFNEGGESEFSNVMICETKVKRVPGASDYPVKELSTPPSSSGNAGNVGPATSPARSSDMLYLIVGCVLGVMVLILMVFIALCLWKSRQQSTIQKYDPPGYLYQGSEINGQMVEYTTLSGAARINGSVHGGFLSNGCSHLHHKGPSGVNGTLSGNINGGLYSAHTNSLTRACVEFEHPHHLVNSGGVYTAVPQMDPLECINCRNCRNNNRCFTKTNSPLPVVPVVASYPQGGLEMKPLNAMKVPVCPASTVPDHGQLPDDCVKDSVAPIPTQHTCCQDNISDINSDSTEDTAEFSRGDSSGHSEAEDKVFSWNPLILSPVLEDCGEKTARSPPGPPLDGLSVVLQQAQET DIP protein Q32MD9 original sequence version: 67 DIP protein Q32MD9 original sequence version: 47 DIP protein Q32MD9 original sequence version: 66 mint Component of a cell-surface receptor complex that mediates cell-cell interactions between muscle precursor cells. Promotes differentiation of myogenic cells. Required for response to NTN3 and activation of NFATC3 11ECD241176C2BFC casp9_mouse Caspase-9 Casp9 Mch6 Apoptotic protease Mch-6 Apoptotic protease-activating factor 3 ICE-like apoptotic protease 6 protein protein mouse Mus musculus Mouse MDEADRQLLRRCRVRLVSELQVAELWDALLSRELFTRDMIEDIQQAGSGSRRDQARQLVTDLETRGRQALPLFISCLEDTGQGTLASLLQSGRQAAKQDPEAVKPLDHLVPVVLGPMGLTAKEQRVVKLDPSQPAVGNLTPVVLGPEELWPARLKPEVLRPETPRPVDIGSGGAHDVCVPGKIRGHADMAYTLDSDPCGHCLIINNVNFCPSSGLGTRTGSNLDRDKLEHRFRWLRFMVEVKNDLTAKKMVTALMEMAHRNHRALDCFVVVILSHGCQASHLQFPGAVYGTDGCSVSIEKIVNIFNGSGCPSLGGKPKLFFIQACGGEQKDHGFEVACTSSQGRTLDSDSEPDAVPYQEGPRPLDQLDAVSSLPTPSDILVSYSTFPGFVSWRDKKSGSWYIETLDGILEQWARSEDLQSLLLRVANAVSAKGTYKQIPGCFNFLRKKLFFKTS DIP protein Q8C3Q9 original sequence version: 106 438A67EA66A6EE78 casp3_human Caspase-3 Apopain Cysteine protease CPP32 Protein Yama SREBP cleavage activity 1 CASP3 CPP32 protein protein human Homo sapiens Human MENTENSVDSKSIKNLEPKIIHGSESMDSGISLDNSYKMDYPEMGLCIIINNKNFHKSTGMTSRSGTDVDAANLRETFRNLKYEVRNKNDLTREEIVELMRDVSKEDHSKRSSFVCVLLSHGEEGIIFGTNGPVDLKKITNFFRGDRCRSLTGKPKLFIIQACRGTELDCGIETDSGVDDDMACHKIPVEADFLYAYSTAPGYYSWRNSKDGSWFIQSLCAMLKQYADKLEFMHILTRVNRKVATEFESFSFDATFHAKKQIPCIVSMLTKELYFYH DIP protein P42574 original sequence version: 108 DIP protein P42574 original sequence version: 171 DIP protein P42574 original sequence version: 111 DIP protein P42574 original sequence version: 105 DIP protein P42574 original sequence version: 131 DIP protein P42574 original sequence version: 132 DIP protein P42574 original sequence version: 134 DIP protein P42574 original sequence version: 162 DIP protein P42574 original sequence version: 189 DIP protein P42574 original sequence version: 167 2F35CD3BCF7FF64A casp9_human Caspase-9 ICE-like apoptotic protease 6 Apoptotic protease Mch-6 Apoptotic protease-activating factor 3 CASP9 MCH6 protein protein human Homo sapiens Human MDEADRRLLRRCRLRLVEELQVDQLWDALLSRELFRPHMIEDIQRAGSGSRRDQARQLIIDLETRGSQALPLFISCLEDTGQDMLASFLRTNRQAAKLSKPTLENLTPVVLRPEIRKPEVLRPETPRPVDIGSGGFGDVGALESLRGNADLAYILSMEPCGHCLIINNVNFCRESGLRTRTGSNIDCEKLRRRFSSLHFMVEVKGDLTAKKMVLALLELAQQDHGALDCCVVVILSHGCQASHLQFPGAVYGTDGCPVSVEKIVNIFNGTSCPSLGGKPKLFFIQACGGEQKDHGFEVASTSPEDESPGSNPEPDATPFQEGLRTFDQLDAISSLPTPSDIFVSYSTFPGFVSWRDPKSGSWYVETLDDIFEQWAHSEDLQSLLLRVANAVSVKGIYKQMPGCFNFLRKKLFFKTS DIP protein P55211 original sequence version: 174 DIP protein P55211 original sequence version: 167 DIP protein P55211 original sequence version: 124 DIP protein P55211 original sequence version: 125 DIP protein P55211 original sequence version: 123 DIP protein P55211 original sequence version: 153 78E0180DF2A3BDD2 casp9-cdon-1 3 4 unspecified role unspecified role prey prey mouse Mus musculus Mouse 5 unspecified role unspecified role bait bait mouse Mus musculus Mouse physical association physical association cdon-casp9-1 2 4 unspecified role unspecified role bait bait human Homo sapiens Human 7 unspecified role unspecified role prey prey Flag-tag Flag-tag flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged n-term range n-terminal range n-term range n-term range n-terminal range n-term range human Homo sapiens Human physical association physical association casp3-cdon-1 1 4 enzyme target enzyme target substrate substrate unspecified role unspecified role Region 984-1250 Region 984-1250 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain 35S-label 35S-label 35s radiolabel 35s radiolabel 35S s35 radiolabelled S35 s35 radiolabelled 35S S35 undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined Q32MD9:p.Asp1153Asn D1153N mutation decreasing rate mutation decreasing interaction rate mutation decreasing rate substitut analysis substitution analysis substitut analysis certain certain sequence position certain certain certain sequence position certain D N This feature has been corrected as a result of our quality control procedures. The original label was 'D1153N'. Wed May 02 16:46:28 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'asp1153asn' Tue Jun 30 18:28:22 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Asp1153Asn' Q32MD9:p.[Asp1095Asn;Asp1153Asn] D1095N/D1153N mutation decreasing rate mutation decreasing interaction rate mutation decreasing rate substitut analysis substitution analysis substitut analysis certain certain sequence position certain certain certain sequence position certain D N certain certain sequence position certain certain certain sequence position certain D N This feature has been corrected as a result of our quality control procedures. The original label was 'D1095N/D1153N'. Wed May 02 16:05:19 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'asp1095asn,asp1153asn' Tue Jun 30 20:03:05 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.[Asp1095Asn;Asp1153Asn]' Q32MD9:p.[Asp1153Asn;Asp1164Asn] D1153N/D1164N mutation decreasing rate mutation decreasing interaction rate mutation decreasing rate substitut analysis substitution analysis substitut analysis certain certain sequence position certain certain certain sequence position certain D N certain certain sequence position certain certain certain sequence position certain D N This feature has been corrected as a result of our quality control procedures. The original label was 'D1153N/D1164N'. Wed May 02 19:36:05 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'asp1153asn,asp1164asn' Tue Jun 30 16:44:37 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.[Asp1153Asn;Asp1164Asn]' in vitro In vitro 6 enzyme enzyme unspecified role unspecified role ecolx Escherichia coli protein cleavage protein cleavage