DIP Database of Interacting Proteins 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ dip@mbi.ucla.edu Structural basis for the interaction of the Golgi-Associated Retrograde Protein Complex with the t-SNARE Syntaxin 6. Structural basis for the interaction of the Golgi-Associated Retrograde Protein Complex with the t-SNARE Syntaxin 6. Structure (London, England : 1993) 2013 imex curation Abascal-Palacios G., Schindler C., Rojas AL., Bonifacino JS., Hierro A. Only protein-protein interactions in vitro In vitro itc isothermal titration calorimetry ITC ITC itc predetermined predetermined participant predetermined Abascal-Palacios G., Schindler C., Rojas AL., Bonifacino JS., Hierro A. DIP original experiment: DIP-255746X Structure (London, England : 1993) 2013 IMEx Structural basis for the interaction of the Golgi-Associated Retrograde Protein Complex with the t-SNARE Syntaxin 6. Structural basis for the interaction of the Golgi-Associated Retrograde Protein Complex with the t-SNARE Syntaxin 6. Structural basis for the interaction of the Golgi-Associated Retrograde Protein Complex with the t-SNARE Syntaxin 6. Structure (London, England : 1993) 2013 imex curation Abascal-Palacios G., Schindler C., Rojas AL., Bonifacino JS., Hierro A. Only protein-protein interactions in vitro In vitro pull down pull down predetermined predetermined participant predetermined Abascal-Palacios G., Schindler C., Rojas AL., Bonifacino JS., Hierro A. DIP original experiment: DIP-255743X Structure (London, England : 1993) 2013 IMEx Structural basis for the interaction of the Golgi-Associated Retrograde Protein Complex with the t-SNARE Syntaxin 6. Structural basis for the interaction of the Golgi-Associated Retrograde Protein Complex with the t-SNARE Syntaxin 6. Structural basis for the interaction of the Golgi-Associated Retrograde Protein Complex with the t-SNARE Syntaxin 6. Structure (London, England : 1993) 2013 imex curation Abascal-Palacios G., Schindler C., Rojas AL., Bonifacino JS., Hierro A. Only protein-protein interactions in vitro In vitro pull down pull down predetermined predetermined participant predetermined Abascal-Palacios G., Schindler C., Rojas AL., Bonifacino JS., Hierro A. DIP original experiment: DIP-255742X Structure (London, England : 1993) 2013 IMEx Structural basis for the interaction of the Golgi-Associated Retrograde Protein Complex with the t-SNARE Syntaxin 6. Structural basis for the interaction of the Golgi-Associated Retrograde Protein Complex with the t-SNARE Syntaxin 6. Structural basis for the interaction of the Golgi-Associated Retrograde Protein Complex with the t-SNARE Syntaxin 6. Structure (London, England : 1993) 2013 imex curation Abascal-Palacios G., Schindler C., Rojas AL., Bonifacino JS., Hierro A. Only protein-protein interactions yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid predetermined predetermined participant predetermined Abascal-Palacios G., Schindler C., Rojas AL., Bonifacino JS., Hierro A. DIP original experiment: DIP-255737X Structure (London, England : 1993) 2013 IMEx Structural basis for the interaction of the Golgi-Associated Retrograde Protein Complex with the t-SNARE Syntaxin 6. Structural basis for the interaction of the Golgi-Associated Retrograde Protein Complex with the t-SNARE Syntaxin 6. Structural basis for the interaction of the Golgi-Associated Retrograde Protein Complex with the t-SNARE Syntaxin 6. Structure (London, England : 1993) 2013 imex curation Abascal-Palacios G., Schindler C., Rojas AL., Bonifacino JS., Hierro A. Only protein-protein interactions in vitro In vitro itc isothermal titration calorimetry ITC ITC itc predetermined predetermined participant predetermined Abascal-Palacios G., Schindler C., Rojas AL., Bonifacino JS., Hierro A. DIP original experiment: DIP-255745X Structure (London, England : 1993) 2013 IMEx Structural basis for the interaction of the Golgi-Associated Retrograde Protein Complex with the t-SNARE Syntaxin 6. Structural basis for the interaction of the Golgi-Associated Retrograde Protein Complex with the t-SNARE Syntaxin 6. Structural basis for the interaction of the Golgi-Associated Retrograde Protein Complex with the t-SNARE Syntaxin 6. Structure (London, England : 1993) 2013 imex curation Abascal-Palacios G., Schindler C., Rojas AL., Bonifacino JS., Hierro A. Only protein-protein interactions human Homo sapiens Human pull down pull down western blot western blot Immuno blot Immuno blot Abascal-Palacios G., Schindler C., Rojas AL., Bonifacino JS., Hierro A. DIP original experiment: DIP-255749X Structure (London, England : 1993) 2013 IMEx Structural basis for the interaction of the Golgi-Associated Retrograde Protein Complex with the t-SNARE Syntaxin 6. Structural basis for the interaction of the Golgi-Associated Retrograde Protein Complex with the t-SNARE Syntaxin 6. Structural basis for the interaction of the Golgi-Associated Retrograde Protein Complex with the t-SNARE Syntaxin 6. Structure (London, England : 1993) 2013 imex curation Abascal-Palacios G., Schindler C., Rojas AL., Bonifacino JS., Hierro A. Only protein-protein interactions yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid predetermined predetermined participant predetermined Abascal-Palacios G., Schindler C., Rojas AL., Bonifacino JS., Hierro A. DIP original experiment: DIP-255738X Structure (London, England : 1993) 2013 IMEx Structural basis for the interaction of the Golgi-Associated Retrograde Protein Complex with the t-SNARE Syntaxin 6. Structural basis for the interaction of the Golgi-Associated Retrograde Protein Complex with the t-SNARE Syntaxin 6. Structural basis for the interaction of the Golgi-Associated Retrograde Protein Complex with the t-SNARE Syntaxin 6. Structure (London, England : 1993) 2013 imex curation Abascal-Palacios G., Schindler C., Rojas AL., Bonifacino JS., Hierro A. Only protein-protein interactions in vitro In vitro itc isothermal titration calorimetry ITC ITC itc predetermined predetermined participant predetermined Abascal-Palacios G., Schindler C., Rojas AL., Bonifacino JS., Hierro A. DIP original experiment: DIP-255744X Structure (London, England : 1993) 2013 IMEx Structural basis for the interaction of the Golgi-Associated Retrograde Protein Complex with the t-SNARE Syntaxin 6. Structural basis for the interaction of the Golgi-Associated Retrograde Protein Complex with the t-SNARE Syntaxin 6. Structural basis for the interaction of the Golgi-Associated Retrograde Protein Complex with the t-SNARE Syntaxin 6. Structure (London, England : 1993) 2013 imex curation Abascal-Palacios G., Schindler C., Rojas AL., Bonifacino JS., Hierro A. Only protein-protein interactions human Homo sapiens Human pull down pull down western blot western blot Immuno blot Immuno blot Abascal-Palacios G., Schindler C., Rojas AL., Bonifacino JS., Hierro A. DIP original experiment: DIP-255751X Structure (London, England : 1993) 2013 IMEx Structural basis for the interaction of the Golgi-Associated Retrograde Protein Complex with the t-SNARE Syntaxin 6. Structural basis for the interaction of the Golgi-Associated Retrograde Protein Complex with the t-SNARE Syntaxin 6. Structural basis for the interaction of the Golgi-Associated Retrograde Protein Complex with the t-SNARE Syntaxin 6. Structure (London, England : 1993) 2013 imex curation Abascal-Palacios G., Schindler C., Rojas AL., Bonifacino JS., Hierro A. Only protein-protein interactions in vitro In vitro x-ray diffraction x-ray crystallography X-ray X-ray x-ray diffraction predetermined predetermined participant predetermined Abascal-Palacios G., Schindler C., Rojas AL., Bonifacino JS., Hierro A. DIP original experiment: DIP-255748X Structure (London, England : 1993) 2013 IMEx Structural basis for the interaction of the Golgi-Associated Retrograde Protein Complex with the t-SNARE Syntaxin 6. Structural basis for the interaction of the Golgi-Associated Retrograde Protein Complex with the t-SNARE Syntaxin 6. Structural basis for the interaction of the Golgi-Associated Retrograde Protein Complex with the t-SNARE Syntaxin 6. Structure (London, England : 1993) 2013 imex curation Abascal-Palacios G., Schindler C., Rojas AL., Bonifacino JS., Hierro A. Only protein-protein interactions human Homo sapiens Human pull down pull down western blot western blot Immuno blot Immuno blot Abascal-Palacios G., Schindler C., Rojas AL., Bonifacino JS., Hierro A. DIP original experiment: DIP-255750X Structure (London, England : 1993) 2013 IMEx Structural basis for the interaction of the Golgi-Associated Retrograde Protein Complex with the t-SNARE Syntaxin 6. Structural basis for the interaction of the Golgi-Associated Retrograde Protein Complex with the t-SNARE Syntaxin 6. Structural basis for the interaction of the Golgi-Associated Retrograde Protein Complex with the t-SNARE Syntaxin 6. Structure (London, England : 1993) 2013 imex curation Abascal-Palacios G., Schindler C., Rojas AL., Bonifacino JS., Hierro A. Only protein-protein interactions yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid predetermined predetermined participant predetermined Abascal-Palacios G., Schindler C., Rojas AL., Bonifacino JS., Hierro A. DIP original experiment: DIP-255739X Structure (London, England : 1993) 2013 IMEx Structural basis for the interaction of the Golgi-Associated Retrograde Protein Complex with the t-SNARE Syntaxin 6. Structural basis for the interaction of the Golgi-Associated Retrograde Protein Complex with the t-SNARE Syntaxin 6. Structural basis for the interaction of the Golgi-Associated Retrograde Protein Complex with the t-SNARE Syntaxin 6. Structure (London, England : 1993) 2013 imex curation Abascal-Palacios G., Schindler C., Rojas AL., Bonifacino JS., Hierro A. Only protein-protein interactions yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid predetermined predetermined participant predetermined Abascal-Palacios G., Schindler C., Rojas AL., Bonifacino JS., Hierro A. DIP original experiment: DIP-255740X Structure (London, England : 1993) 2013 IMEx Structural basis for the interaction of the Golgi-Associated Retrograde Protein Complex with the t-SNARE Syntaxin 6. Structural basis for the interaction of the Golgi-Associated Retrograde Protein Complex with the t-SNARE Syntaxin 6. Structural basis for the interaction of the Golgi-Associated Retrograde Protein Complex with the t-SNARE Syntaxin 6. Structure (London, England : 1993) 2013 imex curation Abascal-Palacios G., Schindler C., Rojas AL., Bonifacino JS., Hierro A. Only protein-protein interactions yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid predetermined predetermined participant predetermined Abascal-Palacios G., Schindler C., Rojas AL., Bonifacino JS., Hierro A. DIP original experiment: DIP-255741X Structure (London, England : 1993) 2013 IMEx Structural basis for the interaction of the Golgi-Associated Retrograde Protein Complex with the t-SNARE Syntaxin 6. Structural basis for the interaction of the Golgi-Associated Retrograde Protein Complex with the t-SNARE Syntaxin 6. Structural basis for the interaction of the Golgi-Associated Retrograde Protein Complex with the t-SNARE Syntaxin 6. Structure (London, England : 1993) 2013 imex curation Abascal-Palacios G., Schindler C., Rojas AL., Bonifacino JS., Hierro A. Only protein-protein interactions in vitro In vitro itc isothermal titration calorimetry ITC ITC itc predetermined predetermined participant predetermined Abascal-Palacios G., Schindler C., Rojas AL., Bonifacino JS., Hierro A. DIP original experiment: DIP-255747X Structure (London, England : 1993) 2013 IMEx Structural basis for the interaction of the Golgi-Associated Retrograde Protein Complex with the t-SNARE Syntaxin 6. vamp4_human Vesicle-associated membrane protein 4 VAMP4 protein protein human Homo sapiens Human MPPKFKRHLNDDDVTGSVKSERRNLLEDDSDEEEDFFLRGPSGPRFGPRNDKIKHVQNQVDEVIDVMQENITKVIERGERLDELQDKSESLSDNATAFSNRSKQLRRQMWWRGCKIKAIMALVAAILLLVIIILIVMKYRT DIP protein O75379 original sequence version: 118 DIP protein O75379 original sequence version: 128 DIP protein O75379 original sequence version: 133 556CC682D26CF91E vps52_human Vacuolar protein sorting-associated protein 52 homolog SACM2L SAC2 suppressor of actin mutations 2-like protein VPS52 protein protein human Homo sapiens Human MAAAATMAAAARELVLRAGTSDMEEEEGPLAGGPGLQEPLQLGELDITSDEFILDEVDVHIQANLEDELVKEALKTGVDLRHYSKQVELELQQIEQKSIRDYIQESENIASLHNQITACDAVLERMEQMLGAFQSDLSSISSEIRTLQEQSGAMNIRLRNRQAVRGKLGELVDGLVVPSALVTAILEAPVTEPRFLEQLQELDAKAAAVREQEARGTAACADVRGVLDRLRVKAVTKIREFILQKIYSFRKPMTNYQIPQTALLKYRFFYQFLLGNERATAKEIRDEYVETLSKIYLSYYRSYLGRLMKVQYEEVAEKDDLMGVEDTAKKGFFSKPSLRSRNTIFTLGTRGSVISPTELEAPILVPHTAQRGEQRYPFEALFRSQHYALLDNSCREYLFICEFFVVSGPAAHDLFHAVMGRTLSMTLKHLDSYLADCYDAIAVFLCIHIVLRFRNIAAKRDVPALDRYWEQVLALLWPRFELILEMNVQSVRSTDPQRLGGLDTRPHYITRRYAEFSSALVSINQTIPNERTMQLLGQLQVEVENFVLRVAAEFSSRKEQLVFLINNYDMMLGVLMERAADDSKEVESFQQLLNARTQEFIEELLSPPFGGLVAFVKEAEALIERGQAERLRGEEARVTQLIRGFGSSWKSSVESLSQDVMRSFTNFRNGTSIIQGALTQLIQLYHRFHRVLSQPQLRALPARAELINIHHLMVELKKHKPNF DIP protein Q8N1B4 original sequence version: 89 DIP protein Q8N1B4 original sequence version: 106 C0961E2BE50B24DF q9uid3-1 Vacuolar protein sorting-associated protein 51 homolog VPS51 ANG2 C11orf2 C11orf3 FFR Another new gene 2 protein Protein fat-free homolog PP5382 protein protein human Homo sapiens Human MAAAAAAGPSPGSGPGDSPEGPEGEAPERRRKAHGMLKLYYGLSEGEAAGRPAGPDPLDPTDLNGAHFDPEVYLDKLRRECPLAQLMDSETDMVRQIRALDSDMQTLVYENYNKFISATDTIRKMKNDFRKMEDEMDRLATNMAVITDFSARISATLQDRHERITKLAGVHALLRKLQFLFELPSRLTKCVELGAYGQAVRYQGRAQAVLQQYQHLPSFRAIQDDCQVITARLAQQLRQRFREGGSGAPEQAECVELLLALGEPAEELCEEFLAHARGRLEKELRNLEAELGPSPPAPDVLEFTDHGGSGFVGGLCQVAAAYQELFAAQGPAGAEKLAAFARQLGSRYFALVERRLAQEQGGGDNSLLVRALDRFHRRLRAPGALLAAAGLADAATEIVERVARERLGHHLQGLRAAFLGCLTDVRQALAAPRVAGKEGPGLAELLANVASSILSHIKASLAAVHLFTAKEVSFSNKPYFRGEFCSQGVREGLIVGFVHSMCQTAQSFCDSPGEKGGATPPALLLLLSRLCLDYETATISYILTLTDEQFLVQDQFPVTPVSTLCAEARETARRLLTHYVKVQGLVISQMLRKSVETRDWLSTLEPRNVRAVMKRVVEDTTAIDVQVGLLYEEGVRKAQSSDSSKRTFSVYSSSRQQGRYAPSYTPSAPMDTNLLSNIQKLFSERIDVFSPVEFNKVSVLTGIIKISLKTLLECVRLRTFGRFGLQQVQVDCHFLQLYLWRFVADEELVHLLLDEVVASAALRCPDPVPMEPSVVEVICERG DIP protein Q9UID3-1 original sequence version: 87 DIP protein Q9UID3 original sequence version: 101 vti1a_human Vesicle transport through interaction with t-SNAREs homolog 1A VTI1A Vesicle transport v-SNARE protein Vti1-like 2 Vti1-rp2 protein protein human Homo sapiens Human MSSDFEGYEQDFAVLTAEITSKIARVPRLPPDEKKQMVANVEKQLEEAKELLEQMDLEVREIPPQSRGMYSNRMRSYKQEMGKLETDFKRSRIAYSDEVRNELLGDDGNSSENQRAHLLDNTERLERSSRRLEAGYQIAVETEQIGQEMLENLSHDREKIQRARERLRETDANLGKSSRILTGMLRRIIQNRILLVILGIIVVITILMAITFSVRRH DIP protein Q96AJ9 original sequence version: 92 DIP protein Q96AJ9 original sequence version: 108 3FE5FE787B5958F0 o60499-1 Syntaxin-10 STX10 SYN10 protein protein human Homo sapiens Human MSLEDPFFVVRGEVQKAVNTARGLYQRWCELLQESAAVGREELDWTTNELRNGLRSIEWDLEDLEETIGIVEANPGKFKLPAGDLQERKVFVERMREAVQEMKDHMVSPTAVAFLERNNREILAGKPAAQKSPSDLLDASAVSATSRYIEEQQATQQLIMDEQDQQLEMVSGSIQVLKHMSGRVGEELDEQGIMLDAFAQEMDHTQSRMDGVLRKLAKVSHMTSDRRQWCAIAVLVGVLLLVLILLFSL DIP protein O60499-1 original sequence version: 112 stx6_human Syntaxin-6 STX6 protein protein human Homo sapiens Human MSMEDPFFVVKGEVQKAVNTAQGLFQRWTELLQDPSTATREEIDWTTNELRNNLRSIEWDLEDLDETISIVEANPRKFNLDATELSIRKAFITSTRQVVRDMKDQMSTSSVQALAERKNRQALLGDSGSQNWSTGTTDKYGRLDRELQRANSHFIEEQQAQQQLIVEQQDEQLELVSGSIGVLKNMSQRIGGELEEQAVMLEDFSHELESTQSRLDNVMKKLAKVSHMTSDRRQWCAIAILFAVLLVVLILFLVL DIP protein O43752 original sequence version: 117 DIP protein O43752 original sequence version: 129 DIP protein O43752 original sequence version: 134 CC05C025DE1FE89E vps51-stx10-1 14 20 unspecified role unspecified role prey prey Region 1-103 Region 1-103 sufficient to bind sufficient binding region sufficient to bind deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 18 unspecified role unspecified role bait bait Region 1-299 Region 1-299 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast physical association physical association vps51-vamp4-1 4 16 unspecified role unspecified role prey prey Region 1-114 Region 1-114 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 18 unspecified role unspecified role bait bait yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast physical association physical association stx6-vps51-1 8 21 unspecified role unspecified role unspecified role unspecified role Region 3-110 Region 3-110 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain ecolx Escherichia coli 18 unspecified role unspecified role unspecified role unspecified role Region 1-69 Region 1-69 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain Q9UID3-1:p.Tyr40Ala Y40A mutation disrupting strength mutation disrupting interaction strength mutation disrupting strength alanine scanning alanine scanning certain certain sequence position certain certain certain sequence position certain Y A This feature has been corrected as a result of our quality control procedures. The original label was 'Y40A'. Wed May 02 17:55:38 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'tyr40ala' Tue Jun 30 19:51:43 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Tyr40Ala' Q9UID3-1:p.Tyr41Ala Y41A mutation disrupting strength mutation disrupting interaction strength mutation disrupting strength alanine scanning alanine scanning certain certain sequence position certain certain certain sequence position certain Y A This feature has been corrected as a result of our quality control procedures. The original label was 'Y41A'. Wed May 02 14:57:03 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'tyr41ala' Tue Jun 30 16:45:58 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Tyr41Ala' Q9UID3-1:p.Leu37Ala L37A mutation disrupting strength mutation disrupting interaction strength mutation disrupting strength alanine scanning alanine scanning certain certain sequence position certain certain certain sequence position certain L A This feature has been corrected as a result of our quality control procedures. The original label was 'L37A'. Wed May 02 14:55:54 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'leu37ala' Tue Jun 30 16:18:25 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Leu37Ala' ecolx Escherichia coli direct interaction direct interaction stx10-vps51-1 15 20 unspecified role unspecified role unspecified role unspecified role Region 1-110 Region 1-110 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain O60499-1:p.Asp5Leu D5L mutation disrupting strength mutation disrupting interaction strength mutation disrupting strength substitut analysis substitution analysis substitut analysis certain certain sequence position certain certain certain sequence position certain D L This feature has been corrected as a result of our quality control procedures. The original label was 'D5L'. Wed May 02 17:44:52 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'asp5leu' Tue Jun 30 19:21:16 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Asp5Leu' O60499-1:p.Pro6Ala P6A mutation disrupting strength mutation disrupting interaction strength mutation disrupting strength alanine scanning alanine scanning certain certain sequence position certain certain certain sequence position certain P A This feature has been corrected as a result of our quality control procedures. The original label was 'P6A'. Wed May 02 17:27:37 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'pro6ala' Tue Jun 30 18:04:54 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Pro6Ala' O60499-1:p.Phe7Leu F7L mutation disrupting strength mutation disrupting interaction strength mutation disrupting strength substitut analysis substitution analysis substitut analysis certain certain sequence position certain certain certain sequence position certain F L This feature has been corrected as a result of our quality control procedures. The original label was 'F7L'. Wed May 02 18:00:28 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'phe7leu' Tue Jun 30 16:53:39 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Phe7Leu' O60499-1:p.Arg88Met R88M mutation disrupting strength mutation disrupting interaction strength mutation disrupting strength substitut analysis substitution analysis substitut analysis certain certain sequence position certain certain certain sequence position certain R M This feature has been corrected as a result of our quality control procedures. The original label was 'R88M'. Wed May 02 18:31:22 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'arg88met' Tue Jun 30 17:19:17 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Arg88Met' ecolx Escherichia coli 18 unspecified role unspecified role unspecified role unspecified role Region 1-69 Region 1-69 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain ecolx Escherichia coli direct interaction direct interaction vps51-vps52-5 9 17 unspecified role unspecified role prey prey human Homo sapiens Human 18 unspecified role unspecified role bait bait Region 1-299 Region 1-299 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain Flag-tag Flag-tag flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged c-term range C-terminal range c-term range c-term range C-terminal range c-term range Tag used for western blot detection Strep-tag Strep-tag strep tag strep tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range Q9UID3-1:p.[Tyr40Ala;Tyr41Ala] Y40A/Y41A mutation mutation certain certain sequence position certain certain certain sequence position certain Y A certain certain sequence position certain certain certain sequence position certain Y A This feature has been corrected as a result of our quality control procedures. The original label was 'Y40A/Y41A'. Wed May 02 20:13:18 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'tyr40ala,tyr41ala' Tue Jun 30 18:58:38 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.[Tyr40Ala;Tyr41Ala]' human Homo sapiens Human physical association physical association vps51-stx6-1 7 21 unspecified role unspecified role prey prey Region 1-103 Region 1-103 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 18 unspecified role unspecified role bait bait Region 1-50 Region 1-50 sufficient to bind sufficient binding region sufficient to bind deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain Q9UID3-1:p.[Tyr40Ala;Tyr41Ala] Y40A/Y41A mutation disrupting strength mutation disrupting interaction strength mutation disrupting strength alanine scanning alanine scanning certain certain sequence position certain certain certain sequence position certain Y A certain certain sequence position certain certain certain sequence position certain Y A This feature has been corrected as a result of our quality control procedures. The original label was 'Y40A/Y41A'. Wed May 02 16:49:13 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'tyr40ala,tyr41ala' Tue Jun 30 20:24:19 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.[Tyr40Ala;Tyr41Ala]' yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast physical association physical association stx6-vps51-2 3 21 unspecified role unspecified role bait bait Region 1-103 Region 1-103 sufficient to bind sufficient binding region sufficient to bind deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain GST-tag GST-tag gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range ecolx Escherichia coli 18 unspecified role unspecified role prey prey Region 1-299 Region 1-299 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain Flag-tag Flag-tag flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged c-term range C-terminal range c-term range c-term range C-terminal range c-term range Q9UID3-1:p.[Tyr40Ala;Tyr41Ala] Y40A/Y41A mutation disrupting strength mutation disrupting interaction strength mutation disrupting strength alanine scanning alanine scanning certain certain sequence position certain certain certain sequence position certain Y A certain certain sequence position certain certain certain sequence position certain Y A This feature has been corrected as a result of our quality control procedures. The original label was 'Y40A/Y41A'. Wed May 02 19:33:26 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'tyr40ala,tyr41ala' Tue Jun 30 18:33:33 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.[Tyr40Ala;Tyr41Ala]' human Homo sapiens Human physical association physical association stx6-vps51-3 10 21 unspecified role unspecified role unspecified role unspecified role Region 3-110 Region 3-110 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain ecolx Escherichia coli 18 unspecified role unspecified role unspecified role unspecified role Region 33-49 Region 33-49 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain in vitro In vitro direct interaction direct interaction vps51-stx6-2 11 19 unspecified role unspecified role prey prey human Homo sapiens Human 21 unspecified role unspecified role prey prey human Homo sapiens Human 18 unspecified role unspecified role bait bait Region 1-299 Region 1-299 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain Flag-tag Flag-tag flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged c-term range C-terminal range c-term range c-term range C-terminal range c-term range Tag used for western blot detection Strep-tag Strep-tag strep tag strep tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range Q9UID3-1:p.[Tyr40Ala;Tyr41Ala] Y40A/Y41A mutation disrupting strength mutation disrupting interaction strength mutation disrupting strength alanine scanning alanine scanning certain certain sequence position certain certain certain sequence position certain Y A certain certain sequence position certain certain certain sequence position certain Y A This feature has been corrected as a result of our quality control procedures. The original label was 'Y40A/Y41A'. Wed May 02 14:56:18 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'tyr40ala,tyr41ala' Tue Jun 30 16:26:40 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.[Tyr40Ala;Tyr41Ala]' human Homo sapiens Human association association stx6-vps51-4 5 21 unspecified role unspecified role unspecified role unspecified role Region 3-110 Region 3-110 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain O43752:p.Asp5Leu D5L mutation disrupting strength mutation disrupting interaction strength mutation disrupting strength substitut analysis substitution analysis substitut analysis certain certain sequence position certain certain certain sequence position certain D L This feature has been corrected as a result of our quality control procedures. The original label was 'D5L'. Wed May 02 17:57:31 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'asp5leu' Tue Jun 30 15:46:20 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Asp5Leu' O43752:p.Pro6Ala P6A mutation disrupting strength mutation disrupting interaction strength mutation disrupting strength alanine scanning alanine scanning certain certain sequence position certain certain certain sequence position certain P A This feature has been corrected as a result of our quality control procedures. The original label was 'P6A'. Wed May 02 14:54:15 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'pro6ala' Tue Jun 30 17:36:18 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Pro6Ala' O43752:p.Phe7Leu F7L mutation disrupting strength mutation disrupting interaction strength mutation disrupting strength substitut analysis substitution analysis substitut analysis certain certain sequence position certain certain certain sequence position certain F L This feature has been corrected as a result of our quality control procedures. The original label was 'F7L'. Wed May 02 20:20:22 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'phe7leu' Tue Jun 30 19:59:23 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Phe7Leu' O43752:p.Arg88Met R88M mutation disrupting strength mutation disrupting interaction strength mutation disrupting strength substitut analysis substitution analysis substitut analysis certain certain sequence position certain certain certain sequence position certain R M This feature has been corrected as a result of our quality control procedures. The original label was 'R88M'. Wed May 02 18:13:01 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'arg88met' Tue Jun 30 16:39:15 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Arg88Met' ecolx Escherichia coli 18 unspecified role unspecified role unspecified role unspecified role Region 1-69 Region 1-69 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain ecolx Escherichia coli direct interaction direct interaction vps51-stx10-2 12 20 unspecified role unspecified role prey prey Region 1-103 Region 1-103 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 18 unspecified role unspecified role bait bait Region 1-50 Region 1-50 sufficient to bind sufficient binding region sufficient to bind deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain Q9UID3-1:p.[Tyr40Ala;Tyr41Ala] Y40A/Y41A mutation disrupting strength mutation disrupting interaction strength mutation disrupting strength alanine scanning alanine scanning certain certain sequence position certain certain certain sequence position certain Y A certain certain sequence position certain certain certain sequence position certain Y A This feature has been corrected as a result of our quality control procedures. The original label was 'Y40A/Y41A'. Wed May 02 20:21:27 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'tyr40ala,tyr41ala' Tue Jun 30 18:02:27 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.[Tyr40Ala;Tyr41Ala]' yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast physical association physical association vps51-stx6-3 6 17 unspecified role unspecified role prey prey human Homo sapiens Human 19 unspecified role unspecified role prey prey human Homo sapiens Human 21 unspecified role unspecified role prey prey human Homo sapiens Human 18 unspecified role unspecified role bait bait Region 1-299 Region 1-299 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain Flag-tag Flag-tag flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged c-term range C-terminal range c-term range c-term range C-terminal range c-term range Tag used for western blot detection Strep-tag Strep-tag strep tag strep tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range human Homo sapiens Human association association stx10-vps51-2 1 20 unspecified role unspecified role unspecified role unspecified role Region 1-110 Region 1-110 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain ecolx Escherichia coli 18 unspecified role unspecified role unspecified role unspecified role Region 1-69 Region 1-69 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain Q9UID3-1:p.Tyr40Ala Y40A mutation disrupting strength mutation disrupting interaction strength mutation disrupting strength alanine scanning alanine scanning certain certain sequence position certain certain certain sequence position certain Y A This feature has been corrected as a result of our quality control procedures. The original label was 'Y40A'. Wed May 02 19:16:19 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'tyr40ala' Tue Jun 30 16:50:53 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Tyr40Ala' Q9UID3-1:p.Tyr41Ala Y41A mutation disrupting strength mutation disrupting interaction strength mutation disrupting strength alanine scanning alanine scanning certain certain sequence position certain certain certain sequence position certain Y A This feature has been corrected as a result of our quality control procedures. The original label was 'Y41A'. Wed May 02 14:47:28 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'tyr41ala' Tue Jun 30 17:02:36 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Tyr41Ala' Q9UID3-1:p.Leu37Ala L37A mutation disrupting strength mutation disrupting interaction strength mutation disrupting strength alanine scanning alanine scanning certain certain sequence position certain certain certain sequence position certain L A This feature has been corrected as a result of our quality control procedures. The original label was 'L37A'. Wed May 02 19:52:07 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'leu37ala' Tue Jun 30 19:23:02 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Leu37Ala' ecolx Escherichia coli direct interaction direct interaction stx10-vps51-3 2 20 unspecified role unspecified role bait bait Region 1-232 Region 1-232 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain GST-tag GST-tag gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined ecolx Escherichia coli 18 unspecified role unspecified role prey prey Region 1-299 Region 1-299 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain Flag-tag Flag-tag flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged c-term range C-terminal range c-term range c-term range C-terminal range c-term range Q9UID3-1:p.[Tyr40Ala;Tyr41Ala] Y40A/Y41A mutation disrupting strength mutation disrupting interaction strength mutation disrupting strength alanine scanning alanine scanning certain certain sequence position certain certain certain sequence position certain Y A certain certain sequence position certain certain certain sequence position certain Y A This feature has been corrected as a result of our quality control procedures. The original label was 'Y40A/Y41A'. Wed May 02 14:40:31 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'tyr40ala,tyr41ala' Tue Jun 30 17:38:39 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.[Tyr40Ala;Tyr41Ala]' human Homo sapiens Human physical association physical association vps51-stx6-4 13 21 unspecified role unspecified role prey prey Region 1-103 Region 1-103 sufficient to bind sufficient binding region sufficient to bind deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 18 unspecified role unspecified role bait bait Region 1-299 Region 1-299 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast physical association physical association