DIP Database of Interacting Proteins 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ dip@mbi.ucla.edu Structural basis for regulation of Arp2/3 complex by GMF. Structural basis for regulation of Arp2/3 complex by GMF. Nature structural & molecular biology 2013 imex curation Luan Q., Nolen BJ. Only protein-protein interactions in vitro In vitro pull down pull down predetermined predetermined participant predetermined Luan Q., Nolen BJ. DIP original experiment: DIP-255627X Nature structural & molecular biology 2013 IMEx Structural basis for regulation of Arp2/3 complex by GMF. Structural basis for regulation of Arp2/3 complex by GMF. Structural basis for regulation of Arp2/3 complex by GMF. Nature structural & molecular biology 2013 imex curation Luan Q., Nolen BJ. Only protein-protein interactions in vitro In vitro x-ray diffraction x-ray crystallography X-ray X-ray x-ray diffraction predetermined predetermined participant predetermined Luan Q., Nolen BJ. DIP original experiment: DIP-255626X Nature structural & molecular biology 2013 IMEx Structural basis for regulation of Arp2/3 complex by GMF. arc1b_bovin Actin-related protein 2/3 complex subunit 1B ARPC1B Arp2/3 complex 41 kDa subunit p41-ARC protein protein bovin Bos taurus (Bovine) Bovine MAYHSFLVEPISCHAWNKDRTQIAICPNNHEVHIYEKSGNKWVQVHELKEHNGQVTGIDWAPDSNRIVTCGTDRNAYVWTLKGRTWKPTLVILRINRAARCVRWAPNEKKFAVGSGSRVISICYFEQENDWWVCKHIKKPIRSTVLSLDWHPNSVLLAAGSCDFKCRIFSAYIKEVEERPAPTPWGSKMPFGELMFESSSSCGWVHGVCFSANGSRVAWVSHDSTVCLADADKKMAVATLASETLPLLAVTFITESSLVAAGHDCFPVLFTYDSAAGKLSFGGRLDVPKQSSQRGLTARERFQNLDKKASSEGSAAAGAGLDSLHKNSVSQISVLSGGKAKCSQFCTTGMDGGMSIWDVRSLESALKDLKIV DIP protein Q58CQ2 original sequence version: 33 DIP protein Q58CQ2 original sequence version: 63 DIP protein Q58CQ2 original sequence version: 75 B412F9C50DC93748 arpc4_bovin Actin-related protein 2/3 complex subunit 4 ARPC4 Arp2/3 complex 20 kDa subunit protein protein bovin Bos taurus (Bovine) Bovine MTATLRPYLSAVRATLQAALCLENFSSQVVERHNKPEVEVRSSKELLLQPVTISRNEKEKVLIEGSINSVRVSIAVKQADEIEKILCHKFMRFMMMRAENFFILRRKPVEGYDISFLITNFHTEQMYKHKLVDFVIHFMEEIDKEISEMKLSVNARARIVAEEFLKNF DIP protein Q148J6 original sequence version: 19 DIP protein Q148J6 original sequence version: 50 DIP protein Q148J6 original sequence version: 61 273CCB230AC703DF arpc5_bovin Actin-related protein 2/3 complex subunit 5 ARPC5 Arp2/3 complex 16 kDa subunit protein protein bovin Bos taurus (Bovine) Bovine MSKNTVSSARFRKVDVGEYDENKFVDEEDGGDGQAGPDEGEVDSCLRQGNMTAALQAALKNPPINTKSQAVKDRAGSIVLKVLISFKANDIEKAVQSLDKNGVDLLMKYIYKGFESPSDNSSAVLLQWHEKALAAGGVGSIVRVLTARKTV DIP protein Q3SYX9 original sequence version: 22 DIP protein Q3SYX9 original sequence version: 44 DIP protein Q3SYX9 original sequence version: 53 F39FB10DC68E6F79 arp3_bovin Actin-related protein 3 ACTR3 ARP3 Actin-like protein 3 Actin-2 protein protein bovin Bos taurus (Bovine) Bovine MAGRLPACVVDCGTGYTKLGYAGNTEPQFIIPSCIAIKESAKVGDQAQRRVMKGVDDLDFFIGDEAIEKPTYATKWPIRHGIVEDWDLMERFMEQVIFKYLRAEPEDHYFLLTEPPLNTPENREYTAEIMFESFNVPGLYIAVQAVLALAASWTSRQVGERTLTGTVIDSGDGVTHVIPVAEGYVIGSCIKHIPIAGRDITYFIQQLLRDREVGIPPEQSLETAKAVKERYSYVCPDLVKEFNKYDTDGSKWIKQYTGINAISKKEFSIDVGYERFLGPEIFFHPEFANPDFTQPISEVVDEVIQNCPIDVRRPLYKNIVLSGGSTMFRDFGRRLQRDLKRTVDARLKLSEELSGGRLKPKPIDVQVITHHMQRYAVWFGGSMLASTPEFYQVCHTKKDYEEIGPSICRHNPVFGVMS DIP protein P61157 original sequence version: 44 DIP protein P61157 original sequence version: 74 DIP protein P61157 original sequence version: 86 23E5564198B81C63 arp2_bovin Actin-related protein 2 ACTR2 ARP2 Actin-like protein 2 protein protein bovin Bos taurus (Bovine) Bovine MDSQGRKVVVCDNGTGFVKCGYAGSNFPEHIFPALVGRPIIRSTTKVGNIEIKDLMVGDEASELRSMLEVNYPMENGIVRNWDDMKHLWDYTFGPEKLNIDTRNCKILLTEPPMNPTKNREKIVEVMFETYQFSGVYVAIQAVLTLYAQGLLTGVVVDSGDGVTHICPVYEGFSLPHLTRRLDIAGRDITRYLIKLLLLRGYAFNHSADFETVRMIKEKLCYVGYNIEQEQKLALETTVLVESYTLPDGRIIKVGGERFEAPEALFQPHLINVEGVGVAELLFNTIQAADIDTRSEFYKHIVLSGGSTMYPGLPSRLERELKQLYLERVLKGDVEKLSKFKIRIEDPPRRKHMVFLGGAVLADIMKDKDNFWMTRQEYQEKGVRVLEKLGVTVR DIP protein A7MB62 original sequence version: 6 DIP protein A7MB62 original sequence version: 35 DIP protein A7MB62 original sequence version: 47 1BFA6B442ED1A797 arpc3_bovin Actin-related protein 2/3 complex subunit 3 ARPC3 Arp2/3 complex 21 kDa subunit protein protein bovin Bos taurus (Bovine) Bovine MPAYHSSLMDPDTKLIGNMALLPIRSQFKGPAPRETKDTDIVDEAIYYFKANVFFKNYEIKNEADRTLIYITLYISECLKKLQKCNSKSQGEKEMYTLGITNFPIPGEPGFPLNAIYAKPANKQEDEVMRAYLQQLRQETGLRLCEKVFDPQNDKPSKWWTCFVKRQFMNKSLSGPGQ DIP protein Q3T035 original sequence version: 24 DIP protein Q3T035 original sequence version: 53 DIP protein Q3T035 original sequence version: 66 7149F598B48F0EAC arpc2_bovin Actin-related protein 2/3 complex subunit 2 ARPC2 Arp2/3 complex 34 kDa subunit protein protein bovin Bos taurus (Bovine) Bovine MILLEVNNRIIEETLALKFENAAAGNKPEAVEVTFADFDGVLYHISNPNGDKTKVMVSISLKFYKELQAHGADELLKRVYGSYLVNPESGYNVSLLYDLENLPASKDSIVHQAGMLKRNCFASVFEKYFQFQEEGKEGENRAVIHYRDDETMYVESKKDRVTVVFSTVFKDDDDVVIGKVFMQEFKEGRRASHTAPQVLFSHREPPLELKDTDAAVGDNIGYITFVLFPRHTNASARDNTINLIHTFRDYLHYHIKCSKAYIHTRMRAKTSDFLKVLNRARPDAEKKEMKTITGKTFSSR DIP protein Q3MHR7 original sequence version: 23 DIP protein Q3MHR7 original sequence version: 52 DIP protein Q3MHR7 original sequence version: 63 60801D999BFBF947 gmfg_mouse Glia maturation factor gamma Gmfg protein protein mouse Mus musculus Mouse MSDSLVVCEVDPELKETLRKFRFRKETNNAAIIMKVDKDRQMVVLEDELQNISPEELKLELPERQPRFVVYSYKYVHDDGRVSYPLCFIFSSPVGCKPEQQMMYAGSKNRLVQTAELTKVFEIRTTDDLTETWLKEKLAFFR DIP protein Q9ERL7 original sequence version: 89 actr2-actr3-12 2 10 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli 9 unspecified role unspecified role unspecified role unspecified role bovin Bos taurus (Bovine) Bovine 7 unspecified role unspecified role unspecified role unspecified role bovin Bos taurus (Bovine) Bovine 6 unspecified role unspecified role unspecified role unspecified role bovin Bos taurus (Bovine) Bovine 5 unspecified role unspecified role unspecified role unspecified role bovin Bos taurus (Bovine) Bovine 4 unspecified role unspecified role unspecified role unspecified role bovin Bos taurus (Bovine) Bovine 8 unspecified role unspecified role unspecified role unspecified role bovin Bos taurus (Bovine) Bovine 3 unspecified role unspecified role unspecified role unspecified role bovin Bos taurus (Bovine) Bovine physical association physical association gmfg-arpc2-1 1 10 unspecified role unspecified role bait bait Q9ERL7:p.Met102Ala M102A mutation decreasing strength mutation decreasing interaction strength mutation decreasing strength alanine scanning alanine scanning certain certain sequence position certain certain certain sequence position certain M A This feature has been corrected as a result of our quality control procedures. The original label was 'M102A'. Wed May 02 19:01:04 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'met102ala' Tue Jun 30 18:03:54 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Met102Ala' Q9ERL7:p.Arg124Glu R124E mutation decreasing strength mutation decreasing interaction strength mutation decreasing strength substitut analysis substitution analysis substitut analysis certain certain sequence position certain certain certain sequence position certain R E This feature has been corrected as a result of our quality control procedures. The original label was 'R124E'. Wed May 02 16:57:50 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'arg124glu' Tue Jun 30 18:38:11 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Arg124Glu' Q9ERL7:p.Asp128Lys D128K mutation decreasing strength mutation decreasing interaction strength mutation decreasing strength substitut analysis substitution analysis substitut analysis certain certain sequence position certain certain certain sequence position certain D K This feature has been corrected as a result of our quality control procedures. The original label was 'D128K'. Wed May 02 19:39:21 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'asp128lys' Tue Jun 30 17:14:34 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Asp128Lys' GST-tag GST-tag gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range ecolx Escherichia coli 9 unspecified role unspecified role prey prey bovin Bos taurus (Bovine) Bovine physical association physical association Deletion of region 1-7 decreased the interaction rate/strength.