DIP Database of Interacting Proteins 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ dip@mbi.ucla.edu LRG1 promotes angiogenesis by modulating endothelial TGF-β signalling. LRG1 promotes angiogenesis by modulating endothelial TGF-β signalling. Nature 2013 imex curation Wang X., Abraham S., McKenzie JA., Jeffs N., Swire M., Tripathi VB., Luhmann UF., Lange CA., Zhai Z., Arthur HM., Bainbridge JW., Moss SE., Greenwood J. Only protein-protein interactions in vitro In vitro anti bait coip anti bait coimmunoprecipitation anti bait coip anti tag western anti tag western blot anti tag western Wang X., Abraham S., McKenzie JA., Jeffs N., Swire M., Tripathi VB., Luhmann UF., Lange CA., Zhai Z., Arthur HM., Bainbridge JW., Moss SE., Greenwood J. DIP original experiment: DIP-253521X Nature 2013 IMEx LRG1 promotes angiogenesis by modulating endothelial TGF-β signalling. LRG1 promotes angiogenesis by modulating endothelial TGF-β signalling. LRG1 promotes angiogenesis by modulating endothelial TGF-β signalling. Nature 2013 imex curation Wang X., Abraham S., McKenzie JA., Jeffs N., Swire M., Tripathi VB., Luhmann UF., Lange CA., Zhai Z., Arthur HM., Bainbridge JW., Moss SE., Greenwood J. Only protein-protein interactions mouse Mus musculus Mouse anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Wang X., Abraham S., McKenzie JA., Jeffs N., Swire M., Tripathi VB., Luhmann UF., Lange CA., Zhai Z., Arthur HM., Bainbridge JW., Moss SE., Greenwood J. DIP original experiment: DIP-253513X Nature 2013 IMEx LRG1 promotes angiogenesis by modulating endothelial TGF-β signalling. LRG1 promotes angiogenesis by modulating endothelial TGF-β signalling. LRG1 promotes angiogenesis by modulating endothelial TGF-β signalling. Nature 2013 imex curation Wang X., Abraham S., McKenzie JA., Jeffs N., Swire M., Tripathi VB., Luhmann UF., Lange CA., Zhai Z., Arthur HM., Bainbridge JW., Moss SE., Greenwood J. Only protein-protein interactions human Homo sapiens Human anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Wang X., Abraham S., McKenzie JA., Jeffs N., Swire M., Tripathi VB., Luhmann UF., Lange CA., Zhai Z., Arthur HM., Bainbridge JW., Moss SE., Greenwood J. DIP original experiment: DIP-253508X Nature 2013 IMEx LRG1 promotes angiogenesis by modulating endothelial TGF-β signalling. LRG1 promotes angiogenesis by modulating endothelial TGF-β signalling. LRG1 promotes angiogenesis by modulating endothelial TGF-β signalling. Nature 2013 imex curation Wang X., Abraham S., McKenzie JA., Jeffs N., Swire M., Tripathi VB., Luhmann UF., Lange CA., Zhai Z., Arthur HM., Bainbridge JW., Moss SE., Greenwood J. Only protein-protein interactions in vitro In vitro anti bait coip anti bait coimmunoprecipitation anti bait coip predetermined predetermined participant predetermined Wang X., Abraham S., McKenzie JA., Jeffs N., Swire M., Tripathi VB., Luhmann UF., Lange CA., Zhai Z., Arthur HM., Bainbridge JW., Moss SE., Greenwood J. DIP original experiment: DIP-253519X Nature 2013 IMEx LRG1 promotes angiogenesis by modulating endothelial TGF-β signalling. LRG1 promotes angiogenesis by modulating endothelial TGF-β signalling. LRG1 promotes angiogenesis by modulating endothelial TGF-β signalling. Nature 2013 imex curation Wang X., Abraham S., McKenzie JA., Jeffs N., Swire M., Tripathi VB., Luhmann UF., Lange CA., Zhai Z., Arthur HM., Bainbridge JW., Moss SE., Greenwood J. Only protein-protein interactions in vitro In vitro anti bait coip anti bait coimmunoprecipitation anti bait coip predetermined predetermined participant predetermined Wang X., Abraham S., McKenzie JA., Jeffs N., Swire M., Tripathi VB., Luhmann UF., Lange CA., Zhai Z., Arthur HM., Bainbridge JW., Moss SE., Greenwood J. DIP original experiment: DIP-253526X Nature 2013 IMEx LRG1 promotes angiogenesis by modulating endothelial TGF-β signalling. LRG1 promotes angiogenesis by modulating endothelial TGF-β signalling. LRG1 promotes angiogenesis by modulating endothelial TGF-β signalling. Nature 2013 imex curation Wang X., Abraham S., McKenzie JA., Jeffs N., Swire M., Tripathi VB., Luhmann UF., Lange CA., Zhai Z., Arthur HM., Bainbridge JW., Moss SE., Greenwood J. Only protein-protein interactions mouse Mus musculus Mouse anti bait coip anti bait coimmunoprecipitation anti bait coip predetermined predetermined participant predetermined Wang X., Abraham S., McKenzie JA., Jeffs N., Swire M., Tripathi VB., Luhmann UF., Lange CA., Zhai Z., Arthur HM., Bainbridge JW., Moss SE., Greenwood J. DIP original experiment: DIP-253516X Nature 2013 IMEx LRG1 promotes angiogenesis by modulating endothelial TGF-β signalling. LRG1 promotes angiogenesis by modulating endothelial TGF-β signalling. LRG1 promotes angiogenesis by modulating endothelial TGF-β signalling. Nature 2013 imex curation Wang X., Abraham S., McKenzie JA., Jeffs N., Swire M., Tripathi VB., Luhmann UF., Lange CA., Zhai Z., Arthur HM., Bainbridge JW., Moss SE., Greenwood J. Only protein-protein interactions human Homo sapiens Human anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Wang X., Abraham S., McKenzie JA., Jeffs N., Swire M., Tripathi VB., Luhmann UF., Lange CA., Zhai Z., Arthur HM., Bainbridge JW., Moss SE., Greenwood J. DIP original experiment: DIP-253511X Nature 2013 IMEx LRG1 promotes angiogenesis by modulating endothelial TGF-β signalling. LRG1 promotes angiogenesis by modulating endothelial TGF-β signalling. LRG1 promotes angiogenesis by modulating endothelial TGF-β signalling. Nature 2013 imex curation Wang X., Abraham S., McKenzie JA., Jeffs N., Swire M., Tripathi VB., Luhmann UF., Lange CA., Zhai Z., Arthur HM., Bainbridge JW., Moss SE., Greenwood J. Only protein-protein interactions in vitro In vitro anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Wang X., Abraham S., McKenzie JA., Jeffs N., Swire M., Tripathi VB., Luhmann UF., Lange CA., Zhai Z., Arthur HM., Bainbridge JW., Moss SE., Greenwood J. DIP original experiment: DIP-253522X Nature 2013 IMEx LRG1 promotes angiogenesis by modulating endothelial TGF-β signalling. LRG1 promotes angiogenesis by modulating endothelial TGF-β signalling. LRG1 promotes angiogenesis by modulating endothelial TGF-β signalling. Nature 2013 imex curation Wang X., Abraham S., McKenzie JA., Jeffs N., Swire M., Tripathi VB., Luhmann UF., Lange CA., Zhai Z., Arthur HM., Bainbridge JW., Moss SE., Greenwood J. Only protein-protein interactions in vitro In vitro spr surface plasmon resonance Optical biosensor BIAcore(r) BIAcore(r) Optical biosensor spr predetermined predetermined participant predetermined Wang X., Abraham S., McKenzie JA., Jeffs N., Swire M., Tripathi VB., Luhmann UF., Lange CA., Zhai Z., Arthur HM., Bainbridge JW., Moss SE., Greenwood J. DIP original experiment: DIP-253512X Nature 2013 IMEx LRG1 promotes angiogenesis by modulating endothelial TGF-β signalling. LRG1 promotes angiogenesis by modulating endothelial TGF-β signalling. LRG1 promotes angiogenesis by modulating endothelial TGF-β signalling. Nature 2013 imex curation Wang X., Abraham S., McKenzie JA., Jeffs N., Swire M., Tripathi VB., Luhmann UF., Lange CA., Zhai Z., Arthur HM., Bainbridge JW., Moss SE., Greenwood J. Only protein-protein interactions human Homo sapiens Human anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Wang X., Abraham S., McKenzie JA., Jeffs N., Swire M., Tripathi VB., Luhmann UF., Lange CA., Zhai Z., Arthur HM., Bainbridge JW., Moss SE., Greenwood J. DIP original experiment: DIP-253510X Nature 2013 IMEx LRG1 promotes angiogenesis by modulating endothelial TGF-β signalling. LRG1 promotes angiogenesis by modulating endothelial TGF-β signalling. LRG1 promotes angiogenesis by modulating endothelial TGF-β signalling. Nature 2013 imex curation Wang X., Abraham S., McKenzie JA., Jeffs N., Swire M., Tripathi VB., Luhmann UF., Lange CA., Zhai Z., Arthur HM., Bainbridge JW., Moss SE., Greenwood J. Only protein-protein interactions in vitro In vitro anti bait coip anti bait coimmunoprecipitation anti bait coip predetermined predetermined participant predetermined Wang X., Abraham S., McKenzie JA., Jeffs N., Swire M., Tripathi VB., Luhmann UF., Lange CA., Zhai Z., Arthur HM., Bainbridge JW., Moss SE., Greenwood J. DIP original experiment: DIP-253529X Nature 2013 IMEx LRG1 promotes angiogenesis by modulating endothelial TGF-β signalling. LRG1 promotes angiogenesis by modulating endothelial TGF-β signalling. LRG1 promotes angiogenesis by modulating endothelial TGF-β signalling. Nature 2013 imex curation Wang X., Abraham S., McKenzie JA., Jeffs N., Swire M., Tripathi VB., Luhmann UF., Lange CA., Zhai Z., Arthur HM., Bainbridge JW., Moss SE., Greenwood J. Only protein-protein interactions in vitro In vitro anti bait coip anti bait coimmunoprecipitation anti bait coip predetermined predetermined participant predetermined Wang X., Abraham S., McKenzie JA., Jeffs N., Swire M., Tripathi VB., Luhmann UF., Lange CA., Zhai Z., Arthur HM., Bainbridge JW., Moss SE., Greenwood J. DIP original experiment: DIP-253518X Nature 2013 IMEx LRG1 promotes angiogenesis by modulating endothelial TGF-β signalling. LRG1 promotes angiogenesis by modulating endothelial TGF-β signalling. LRG1 promotes angiogenesis by modulating endothelial TGF-β signalling. Nature 2013 imex curation Wang X., Abraham S., McKenzie JA., Jeffs N., Swire M., Tripathi VB., Luhmann UF., Lange CA., Zhai Z., Arthur HM., Bainbridge JW., Moss SE., Greenwood J. Only protein-protein interactions in vitro In vitro anti bait coip anti bait coimmunoprecipitation anti bait coip predetermined predetermined participant predetermined Wang X., Abraham S., McKenzie JA., Jeffs N., Swire M., Tripathi VB., Luhmann UF., Lange CA., Zhai Z., Arthur HM., Bainbridge JW., Moss SE., Greenwood J. DIP original experiment: DIP-253527X Nature 2013 IMEx LRG1 promotes angiogenesis by modulating endothelial TGF-β signalling. LRG1 promotes angiogenesis by modulating endothelial TGF-β signalling. LRG1 promotes angiogenesis by modulating endothelial TGF-β signalling. Nature 2013 imex curation Wang X., Abraham S., McKenzie JA., Jeffs N., Swire M., Tripathi VB., Luhmann UF., Lange CA., Zhai Z., Arthur HM., Bainbridge JW., Moss SE., Greenwood J. Only protein-protein interactions human Homo sapiens Human anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Wang X., Abraham S., McKenzie JA., Jeffs N., Swire M., Tripathi VB., Luhmann UF., Lange CA., Zhai Z., Arthur HM., Bainbridge JW., Moss SE., Greenwood J. DIP original experiment: DIP-253509X Nature 2013 IMEx LRG1 promotes angiogenesis by modulating endothelial TGF-β signalling. LRG1 promotes angiogenesis by modulating endothelial TGF-β signalling. LRG1 promotes angiogenesis by modulating endothelial TGF-β signalling. Nature 2013 imex curation Wang X., Abraham S., McKenzie JA., Jeffs N., Swire M., Tripathi VB., Luhmann UF., Lange CA., Zhai Z., Arthur HM., Bainbridge JW., Moss SE., Greenwood J. Only protein-protein interactions mouse Mus musculus Mouse anti bait coip anti bait coimmunoprecipitation anti bait coip predetermined predetermined participant predetermined Wang X., Abraham S., McKenzie JA., Jeffs N., Swire M., Tripathi VB., Luhmann UF., Lange CA., Zhai Z., Arthur HM., Bainbridge JW., Moss SE., Greenwood J. DIP original experiment: DIP-253515X Nature 2013 IMEx LRG1 promotes angiogenesis by modulating endothelial TGF-β signalling. LRG1 promotes angiogenesis by modulating endothelial TGF-β signalling. LRG1 promotes angiogenesis by modulating endothelial TGF-β signalling. Nature 2013 imex curation Wang X., Abraham S., McKenzie JA., Jeffs N., Swire M., Tripathi VB., Luhmann UF., Lange CA., Zhai Z., Arthur HM., Bainbridge JW., Moss SE., Greenwood J. Only protein-protein interactions mouse Mus musculus Mouse anti bait coip anti bait coimmunoprecipitation anti bait coip predetermined predetermined participant predetermined Wang X., Abraham S., McKenzie JA., Jeffs N., Swire M., Tripathi VB., Luhmann UF., Lange CA., Zhai Z., Arthur HM., Bainbridge JW., Moss SE., Greenwood J. DIP original experiment: DIP-253514X Nature 2013 IMEx LRG1 promotes angiogenesis by modulating endothelial TGF-β signalling. LRG1 promotes angiogenesis by modulating endothelial TGF-β signalling. LRG1 promotes angiogenesis by modulating endothelial TGF-β signalling. Nature 2013 imex curation Wang X., Abraham S., McKenzie JA., Jeffs N., Swire M., Tripathi VB., Luhmann UF., Lange CA., Zhai Z., Arthur HM., Bainbridge JW., Moss SE., Greenwood J. Only protein-protein interactions in vitro In vitro anti bait coip anti bait coimmunoprecipitation anti bait coip predetermined predetermined participant predetermined Wang X., Abraham S., McKenzie JA., Jeffs N., Swire M., Tripathi VB., Luhmann UF., Lange CA., Zhai Z., Arthur HM., Bainbridge JW., Moss SE., Greenwood J. DIP original experiment: DIP-253517X Nature 2013 IMEx LRG1 promotes angiogenesis by modulating endothelial TGF-β signalling. LRG1 promotes angiogenesis by modulating endothelial TGF-β signalling. LRG1 promotes angiogenesis by modulating endothelial TGF-β signalling. Nature 2013 imex curation Wang X., Abraham S., McKenzie JA., Jeffs N., Swire M., Tripathi VB., Luhmann UF., Lange CA., Zhai Z., Arthur HM., Bainbridge JW., Moss SE., Greenwood J. Only protein-protein interactions in vitro In vitro anti bait coip anti bait coimmunoprecipitation anti bait coip predetermined predetermined participant predetermined Wang X., Abraham S., McKenzie JA., Jeffs N., Swire M., Tripathi VB., Luhmann UF., Lange CA., Zhai Z., Arthur HM., Bainbridge JW., Moss SE., Greenwood J. DIP original experiment: DIP-253528X Nature 2013 IMEx LRG1 promotes angiogenesis by modulating endothelial TGF-β signalling. LRG1 promotes angiogenesis by modulating endothelial TGF-β signalling. LRG1 promotes angiogenesis by modulating endothelial TGF-β signalling. Nature 2013 imex curation Wang X., Abraham S., McKenzie JA., Jeffs N., Swire M., Tripathi VB., Luhmann UF., Lange CA., Zhai Z., Arthur HM., Bainbridge JW., Moss SE., Greenwood J. Only protein-protein interactions in vitro In vitro anti bait coip anti bait coimmunoprecipitation anti bait coip predetermined predetermined participant predetermined Wang X., Abraham S., McKenzie JA., Jeffs N., Swire M., Tripathi VB., Luhmann UF., Lange CA., Zhai Z., Arthur HM., Bainbridge JW., Moss SE., Greenwood J. DIP original experiment: DIP-253530X Nature 2013 IMEx LRG1 promotes angiogenesis by modulating endothelial TGF-β signalling. LRG1 promotes angiogenesis by modulating endothelial TGF-β signalling. LRG1 promotes angiogenesis by modulating endothelial TGF-β signalling. Nature 2013 imex curation Wang X., Abraham S., McKenzie JA., Jeffs N., Swire M., Tripathi VB., Luhmann UF., Lange CA., Zhai Z., Arthur HM., Bainbridge JW., Moss SE., Greenwood J. Only protein-protein interactions in vitro In vitro anti bait coip anti bait coimmunoprecipitation anti bait coip anti tag western anti tag western blot anti tag western Wang X., Abraham S., McKenzie JA., Jeffs N., Swire M., Tripathi VB., Luhmann UF., Lange CA., Zhai Z., Arthur HM., Bainbridge JW., Moss SE., Greenwood J. DIP original experiment: DIP-253523X Nature 2013 IMEx LRG1 promotes angiogenesis by modulating endothelial TGF-β signalling. LRG1 promotes angiogenesis by modulating endothelial TGF-β signalling. LRG1 promotes angiogenesis by modulating endothelial TGF-β signalling. Nature 2013 imex curation Wang X., Abraham S., McKenzie JA., Jeffs N., Swire M., Tripathi VB., Luhmann UF., Lange CA., Zhai Z., Arthur HM., Bainbridge JW., Moss SE., Greenwood J. Only protein-protein interactions in vitro In vitro anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Wang X., Abraham S., McKenzie JA., Jeffs N., Swire M., Tripathi VB., Luhmann UF., Lange CA., Zhai Z., Arthur HM., Bainbridge JW., Moss SE., Greenwood J. DIP original experiment: DIP-253524X Nature 2013 IMEx LRG1 promotes angiogenesis by modulating endothelial TGF-β signalling. LRG1 promotes angiogenesis by modulating endothelial TGF-β signalling. LRG1 promotes angiogenesis by modulating endothelial TGF-β signalling. Nature 2013 imex curation Wang X., Abraham S., McKenzie JA., Jeffs N., Swire M., Tripathi VB., Luhmann UF., Lange CA., Zhai Z., Arthur HM., Bainbridge JW., Moss SE., Greenwood J. Only protein-protein interactions in vitro In vitro anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Wang X., Abraham S., McKenzie JA., Jeffs N., Swire M., Tripathi VB., Luhmann UF., Lange CA., Zhai Z., Arthur HM., Bainbridge JW., Moss SE., Greenwood J. DIP original experiment: DIP-253520X Nature 2013 IMEx LRG1 promotes angiogenesis by modulating endothelial TGF-β signalling. LRG1 promotes angiogenesis by modulating endothelial TGF-β signalling. LRG1 promotes angiogenesis by modulating endothelial TGF-β signalling. Nature 2013 imex curation Wang X., Abraham S., McKenzie JA., Jeffs N., Swire M., Tripathi VB., Luhmann UF., Lange CA., Zhai Z., Arthur HM., Bainbridge JW., Moss SE., Greenwood J. Only protein-protein interactions in vitro In vitro anti bait coip anti bait coimmunoprecipitation anti bait coip anti tag western anti tag western blot anti tag western Wang X., Abraham S., McKenzie JA., Jeffs N., Swire M., Tripathi VB., Luhmann UF., Lange CA., Zhai Z., Arthur HM., Bainbridge JW., Moss SE., Greenwood J. DIP original experiment: DIP-253525X Nature 2013 IMEx LRG1 promotes angiogenesis by modulating endothelial TGF-β signalling. egln_human Endoglin ENG END protein protein human Homo sapiens Human MDRGTLPLAVALLLASCSLSPTSLAETVHCDLQPVGPERGEVTYTTSQVSKGCVAQAPNAILEVHVLFLEFPTGPSQLELTLQASKQNGTWPREVLLVLSVNSSVFLHLQALGIPLHLAYNSSLVTFQEPPGVNTTELPSFPKTQILEWAAERGPITSAAELNDPQSILLRLGQAQGSLSFCMLEASQDMGRTLEWRPRTPALVRGCHLEGVAGHKEAHILRVLPGHSAGPRTVTVKVELSCAPGDLDAVLILQGPPYVSWLIDANHNMQIWTTGEYSFKIFPEKNIRGFKLPDTPQGLLGEARMLNASIVASFVELPLASIVSLHASSCGGRLQTSPAPIQTTPPKDTCSPELLMSLIQTKCADDAMTLVLKKELVAHLKCTITGLTFWDPSCEAEDRGDKFVLRSAYSSCGMQVSASMISNEAVVNILSSSSPQRKKVHCLNMDSLSFQLGLYLSPHFLQASNTIEPGQQSFVQVRVSPSVSEFLLQLDSCHLDLGPEGGTVELIQGRAAKGNCVSLLSPSPEGDPRFSFLLHFYTVPIPKTGTLSCTVALRPKTGSQDQEVHRTVFMRLNIISPDLSGCTSKGLVLPAVLGITFGAFLIGALLTAALWYIYSHTRSPSKREPVVAVAAPASSESSSTNHSIGSTQSTPCSTSSMA DIP protein P17813 original sequence version: 151 49CA2CE013298D17 tgfr1_mouse TGF-beta receptor type-1 Tgfbr1 Transforming growth factor-beta receptor type I ESK2 protein protein mouse Mus musculus Mouse MEAAAAAPRRPQLLIVLVAAATLLPGAKALQCFCHLCTKDNFTCETDGLCFVSVTETTDKVIHNSMCIAEIDLIPRDRPFVCAPSSKTGAVTTTYCCNQDHCNKIELPTTGPFSEKQSAGLGPVELAAVIAGPVCFVCIALMLMVYICHNRTVIHHRVPNEEDPSLDRPFISEGTTLKDLIYDMTTSGSGSGLPLLVQRTIARTIVLQESIGKGRFGEVWRGKWRGEEVAVKIFSSREERSWFREAEIYQTVMLRHENILGFIAADNKDNGTWTQLWLVSDYHEHGSLFDYLNRYTVTVEGMIKLALSTASGLAHLHMEIVGTQGKPAIAHRDLKSKNILVKKNGTCCIADLGLAVRHDSATDTIDIAPNHRVGTKRYMAPEVLDDSINMKHFESFKRADIYAMGLVFWEIARRCSIGGIHEDYQLPYYDLVPSDPSVEEMRKVVCEQKLRPNIPNRWQSCEALRVMAKIMRECWYANGAARLTALRIKKTLSQLSQQEGIKM DIP protein Q64729 original sequence version: 120 DIP protein Q64729 original sequence version: 131 DIP protein Q64729 original sequence version: 157 BB8BB6D2261793AF tgfr2_human TGF-beta receptor type-2 TGFBR2 Transforming growth factor-beta receptor type II TGF-beta type II receptor protein protein human Homo sapiens Human MGRGLLRGLWPLHIVLWTRIASTIPPHVQKSVNNDMIVTDNNGAVKFPQLCKFCDVRFSTCDNQKSCMSNCSITSICEKPQEVCVAVWRKNDENITLETVCHDPKLPYHDFILEDAASPKCIMKEKKKPGETFFMCSCSSDECNDNIIFSEEYNTSNPDLLLVIFQVTGISLLPPLGVAISVIIIFYCYRVNRQQKLSSTWETGKTRKLMEFSEHCAIILEDDRSDISSTCANNINHNTELLPIELDTLVGKGRFAEVYKAKLKQNTSEQFETVAVKIFPYEEYASWKTEKDIFSDINLKHENILQFLTAEERKTELGKQYWLITAFHAKGNLQEYLTRHVISWEDLRKLGSSLARGIAHLHSDHTPCGRPKMPIVHRDLKSSNILVKNDLTCCLCDFGLSLRLDPTLSVDDLANSGQVGTARYMAPEVLESRMNLENVESFKQTDVYSMALVLWEMTSRCNAVGEVKDYEPPFGSKVREHPCVESMKDNVLRDRGRPEIPSFWLNHQGIQMVCETLTECWDHDPEARLTAQCVAERFSELEHLDRLSGRSCSEEKIPEDGSLNTTK DIP protein P37173 original sequence version: 163 C541DA751FFBDBEB tgfr1_human TGF-beta receptor type-1 TGFBR1 Transforming growth factor-beta receptor type I TGF-beta type I receptor Serine/threonine-protein kinase receptor R4 Activin receptor-like kinase 5 ALK5 SKR4 Activin A receptor type II-like protein kinase of 53kD protein protein human Homo sapiens Human MEAAVAAPRPRLLLLVLAAAAAAAAALLPGATALQCFCHLCTKDNFTCVTDGLCFVSVTETTDKVIHNSMCIAEIDLIPRDRPFVCAPSSKTGSVTTTYCCNQDHCNKIELPTTVKSSPGLGPVELAAVIAGPVCFVCISLMLMVYICHNRTVIHHRVPNEEDPSLDRPFISEGTTLKDLIYDMTTSGSGSGLPLLVQRTIARTIVLQESIGKGRFGEVWRGKWRGEEVAVKIFSSREERSWFREAEIYQTVMLRHENILGFIAADNKDNGTWTQLWLVSDYHEHGSLFDYLNRYTVTVEGMIKLALSTASGLAHLHMEIVGTQGKPAIAHRDLKSKNILVKKNGTCCIADLGLAVRHDSATDTIDIAPNHRVGTKRYMAPEVLDDSINMKHFESFKRADIYAMGLVFWEIARRCSIGGIHEDYQLPYYDLVPSDPSVEEMRKVVCEQKLRPNIPNRWQSCEALRVMAKIMRECWYANGAARLTALRIKKTLSQLSQQEGIKM DIP protein P36897 original sequence version: 161 179F11404725DDCB tgfr2_mouse TGF-beta receptor type-2 Tgfbr2 Transforming growth factor-beta receptor type II TGF-beta type II receptor protein protein mouse Mus musculus Mouse MGRGLLRGLWPLHIVLWTRIASTIPPHVPKSDVEMEAQKDASIHLSCNRTIHPLKHFNSDVMASDNGGAVKLPQLCKFCDVRLSTCDNQKSCMSNCSITAICEKPHEVCVAVWRKNDKNITLETVCHDPKLTYHGFTLEDAASPKCVMKEKKRAGETFFMCACNMEECNDYIIFSEEYTTSSPDLLLVIIQVTGVSLLPPLGIAIAVIIIFYCYRVHRQQKLSPSWESSKPRKLMDFSDNCAIILEDDRSDISSTCANNINHNTELLPIELDTLVGKGRFAEVYKAKLKQNTSEQFETVAVKIFPYEEYSSWKTEKDIFSDINLKHENILQFLTAEERKTELGKQYWLITAFHAKGNLQEYLTRHVISWEDLRKLGSSLARGIAHLHSDHTPCGRPKMPIVHRDLKSSNILVKNDLTCCLCDFGLSLRLDPTLSVDDLANSGQVGTARYMAPEVLESRMNLENVESFKQTDVYSMALVLWEMTSRCNAVGEVKDYEPPFGSKVREHPCVESMKDSVLRDRGRPEIPSFWLNHQGIQIVCETLTECWDHDPEARLTAQCVAERFSELEHPERLSGRSCSQEKIPEDGSLNTTK DIP protein Q62312 original sequence version: 121 DIP protein Q62312 original sequence version: 129 1A12D58550921F5E p37173-2 TGF-beta receptor type-2 TGFBR2 TGF-beta type II receptor Transforming growth factor-beta receptor type II protein protein human Homo sapiens Human MGRGLLRGLWPLHIVLWTRIASTIPPHVQKSDVEMEAQKDEIICPSCNRTAHPLRHINNDMIVTDNNGAVKFPQLCKFCDVRFSTCDNQKSCMSNCSITSICEKPQEVCVAVWRKNDENITLETVCHDPKLPYHDFILEDAASPKCIMKEKKKPGETFFMCSCSSDECNDNIIFSEEYNTSNPDLLLVIFQVTGISLLPPLGVAISVIIIFYCYRVNRQQKLSSTWETGKTRKLMEFSEHCAIILEDDRSDISSTCANNINHNTELLPIELDTLVGKGRFAEVYKAKLKQNTSEQFETVAVKIFPYEEYASWKTEKDIFSDINLKHENILQFLTAEERKTELGKQYWLITAFHAKGNLQEYLTRHVISWEDLRKLGSSLARGIAHLHSDHTPCGRPKMPIVHRDLKSSNILVKNDLTCCLCDFGLSLRLDPTLSVDDLANSGQVGTARYMAPEVLESRMNLENVESFKQTDVYSMALVLWEMTSRCNAVGEVKDYEPPFGSKVREHPCVESMKDNVLRDRGRPEIPSFWLNHQGIQMVCETLTECWDHDPEARLTAQCVAERFSELEHLDRLSGRSCSEEKIPEDGSLNTTK DIP protein P37173-2 original sequence version: 163 a2gl_human Leucine-rich alpha-2-glycoprotein LRG1 LRG protein protein human Homo sapiens Human MSSWSRQRPKSPGGIQPHVSRTLFLLLLLAASAWGVTLSPKDCQVFRSDHGSSISCQPPAEIPGYLPADTVHLAVEFFNLTHLPANLLQGASKLQELHLSSNGLESLSPEFLRPVPQLRVLDLTRNALTGLPPGLFQASATLDTLVLKENQLEVLEVSWLHGLKALGHLDLSGNRLRKLPPGLLANFTLLRTLDLGENQLETLPPDLLRGPLQLERLHLEGNKLQVLGKDLLLPQPDLRYLFLNGNKLARVAAGAFQGLRQLDMLDLSNNSLASVPEGLWASLGQPNWDMRDGFDISGNPWICDQNLSDLYRWLQAQKDKMFSQNDTRCAGPEAVKGQTLLAVAKSQ DIP protein P02750 original sequence version: 127 20C99ED50152FA9C egln_mouse Endoglin Eng Cell surface MJ7/18 antigen Edg protein protein mouse Mus musculus Mouse MDRGVLPLPITLLFVIYSFVPTTGLAERVGCDLQPVDPTRGEVTFTTSQVSEGCVAQAANAVREVHVLFLDFPGMLSHLELTLQASKQNGTETQEVFLVLVSNKNVFVKFQAPEIPLHLAYDSSLVIFQGQPRVNITVLPSLTSRKQILDWAATKGAITSIAALDDPQSIVLQLGQDPKAPFLCLPEAHKDMGATLEWQPRAQTPVQSCRLEGVSGHKEAYILRILPGSEAGPRTVTVMMELSCTSGDAILILHGPPYVSWFIDINHSMQILTTGEYSVKIFPGSKVKGVELPDTPQGLIAEARKLNASIVTSFVELPLVSNVSLRASSCGGVFQTTPAPVVTTPPKDTCSPVLLMSLIQPKCGNQVMTLALNKKHVQTLQCTITGLTFWDSSCQAEDTDDHLVLSSAYSSCGMKVTAHVVSNEVIISFPSGSPPLRKKVQCIDMDSLSFQLGLYLSPHFLQASNTIELGQQAFVQVSVSPLTSEVTVQLDSCHLDLGPEGDMVELIQSRTAKGSCVTLLSPSPEGDPRFSFLLRVYMVPTPTAGTLSCNLALRPSTLSQEVYKTVSMRLNIVSPDLSGKGLVLPSVLGITFGAFLIGALLTAALWYIYSHTRGPSKREPVVAVAAPASSESSSTNHSIGSTQSTPCSTSSMA DIP protein Q63961 original sequence version: 101 mint AD9DD2F823FB06A1 p17813-1 Endoglin ENG END protein protein human Homo sapiens Human MDRGTLPLAVALLLASCSLSPTSLAETVHCDLQPVGPERGEVTYTTSQVSKGCVAQAPNAILEVHVLFLEFPTGPSQLELTLQASKQNGTWPREVLLVLSVNSSVFLHLQALGIPLHLAYNSSLVTFQEPPGVNTTELPSFPKTQILEWAAERGPITSAAELNDPQSILLRLGQAQGSLSFCMLEASQDMGRTLEWRPRTPALVRGCHLEGVAGHKEAHILRVLPGHSAGPRTVTVKVELSCAPGDLDAVLILQGPPYVSWLIDANHNMQIWTTGEYSFKIFPEKNIRGFKLPDTPQGLLGEARMLNASIVASFVELPLASIVSLHASSCGGRLQTSPAPIQTTPPKDTCSPELLMSLIQTKCADDAMTLVLKKELVAHLKCTITGLTFWDPSCEAEDRGDKFVLRSAYSSCGMQVSASMISNEAVVNILSSSSPQRKKVHCLNMDSLSFQLGLYLSPHFLQASNTIEPGQQSFVQVRVSPSVSEFLLQLDSCHLDLGPEGGTVELIQGRAAKGNCVSLLSPSPEGDPRFSFLLHFYTVPIPKTGTLSCTVALRPKTGSQDQEVHRTVFMRLNIISPDLSGCTSKGLVLPAVLGITFGAFLIGALLTAALWYIYSHTRSPSKREPVVAVAAPASSESSSTNHSIGSTQSTPCSTSSMA DIP protein P17813-1 original sequence version: 151 acvl1_mouse Serine/threonine-protein kinase receptor R3 Acvrl1 Acvrlk1 Alk-1 Activin receptor-like kinase 1 TGF-B superfamily receptor type I protein protein mouse Mus musculus Mouse MTLGSFRRGLLMLSVAFGLTRGDLAKPSKLVNCTCESPHCKRPFCQGSWCTVVLVREQGRHPQVYRGCGSLNQELCLGRPTEFLNHHCCYRSFCNHNVSLMLEATQTPSEEPEVDAHLPLILGPVLALPVLVALGALGLWRVRRRQEKQRDLHSDLGESSLILKASEQADSMLGDFLDSDCTTGSGSGLPFLVQRTVARQVALVECVGKGRYGEVWRGSWHGESVAVKIFSSRDEQSWFRETEIYNTVLLRHDNILGFIASDMTSRNSSTQLWLITHYHEHGSLYDFLQRQTLEPQLALRLAVSAACGLAHLHVEIFGTQGKPAIAHRDLKSRNVLVKSNLQCCIADLGLAVMHSQSSDYLDIGNNPRVGTKRYMAPEVLDEHIRTDCFESYKWTDIWAFGLVLWEIARRTIINGIVEDYRPPFYDMVPNDPSFEDMKKVVCVDQQTPTIPNRLAADPVLSGLAQMMRECWYPNPSARLTALRIKKTLQKLSHNPEKPKVIH DIP protein Q61288 original sequence version: 126 mint On ligand binding, forms a receptor complex consisting of two type II and two type I transmembrane serine/threonine kinases. Type II receptors phosphorylate and activate type I receptors which autophosphorylate, then bind and activate SMAD transcriptional regulators. Receptor for TGF-beta. May bind activin as well 439510D3CC740D65 q91xl1_mouse Lrg1 Lrg lrhg protein protein mouse Mus musculus Mouse MVSWQHQGSLQDLKTCLARTLFLLALLGRVSSLKECLILQSAEGSTVSCHGPTEFPSSLPADTVHLSVEFSNLTQLPAAALQGCPGLRELHLSSNRLQALSPELLAPVPRLRALDLTRNALRSLPPGLFSTSANLSTLVLRENQLREVSAQWLQGLDALGHLDLAENQLSSLPSGLLASLGALHTLDLGYNLLESLPEGLLRGPRRLQRLHLEGNRLQRLEDSLLAPQPFLRVLFLNDNQLVGVATGSFQGLQHLDMLDLSNNSLSSTPPGLWAFLGRPTRDMQDGFDISHNPWICDKNLADLCRWLVANRNKMFSQNDTRCAGPEAMKGQRLLDVAELGSL DIP protein Q91XL1 original sequence version: 94 acvl1_human Serine/threonine-protein kinase receptor R3 ACVRL1 ACVRLK1 ALK1 Activin receptor-like kinase 1 TGF-B superfamily receptor type I protein protein human Homo sapiens Human MTLGSPRKGLLMLLMALVTQGDPVKPSRGPLVTCTCESPHCKGPTCRGAWCTVVLVREEGRHPQEHRGCGNLHRELCRGRPTEFVNHYCCDSHLCNHNVSLVLEATQPPSEQPGTDGQLALILGPVLALLALVALGVLGLWHVRRRQEKQRGLHSELGESSLILKASEQGDSMLGDLLDSDCTTGSGSGLPFLVQRTVARQVALVECVGKGRYGEVWRGLWHGESVAVKIFSSRDEQSWFRETEIYNTVLLRHDNILGFIASDMTSRNSSTQLWLITHYHEHGSLYDFLQRQTLEPHLALRLAVSAACGLAHLHVEIFGTQGKPAIAHRDFKSRNVLVKSNLQCCIADLGLAVMHSQGSDYLDIGNNPRVGTKRYMAPEVLDEQIRTDCFESYKWTDIWAFGLVLWEIARRTIVNGIVEDYRPPFYDVVPNDPSFEDMKKVVCVDQQTPTIPNRLAADPVLSGLAQMMRECWYPNPSARLTALRIKKTLQKISNSPEKPKVIQ DIP protein P37023 original sequence version: 153 On ligand binding, forms a receptor complex consisting of two type II and two type I transmembrane serine/threonine kinases. Type II receptors phosphorylate and activate type I receptors which autophosphorylate, then bind and activate SMAD transcriptional regulators. Receptor for TGF-beta. May bind activin as well mint homomint Defects in ACVRL1 are the cause of hereditary hemorrhagic telangiectasia type 2 (HHT2) [MIM:600376]; also known as Osler-Rendu-Weber syndrome 2 (ORW2). HHT2 is an autosomal dominant multisystemic vascular dysplasia, characterized by recurrent epistaxis, muco-cutaneous telangiectases, gastro-intestinal hemorrhage, and pulmonary, cerebral and hepatic arteriovenous malformations; all secondary manifestations of the underlying vascular dysplasia 074522AA802325DD p36897-1 TGF-beta receptor type-1 TGFBR1 ALK5 SKR4 Activin A receptor type II-like protein kinase of 53kD Activin receptor-like kinase 5 Serine/threonine-protein kinase receptor R4 TGF-beta type I receptor Transforming growth factor-beta receptor type I protein protein human Homo sapiens Human MEAAVAAPRPRLLLLVLAAAAAAAAALLPGATALQCFCHLCTKDNFTCVTDGLCFVSVTETTDKVIHNSMCIAEIDLIPRDRPFVCAPSSKTGSVTTTYCCNQDHCNKIELPTTVKSSPGLGPVELAAVIAGPVCFVCISLMLMVYICHNRTVIHHRVPNEEDPSLDRPFISEGTTLKDLIYDMTTSGSGSGLPLLVQRTIARTIVLQESIGKGRFGEVWRGKWRGEEVAVKIFSSREERSWFREAEIYQTVMLRHENILGFIAADNKDNGTWTQLWLVSDYHEHGSLFDYLNRYTVTVEGMIKLALSTASGLAHLHMEIVGTQGKPAIAHRDLKSKNILVKKNGTCCIADLGLAVRHDSATDTIDIAPNHRVGTKRYMAPEVLDDSINMKHFESFKRADIYAMGLVFWEIARRCSIGGIHEDYQLPYYDLVPSDPSVEEMRKVVCEQKLRPNIPNRWQSCEALRVMAKIMRECWYANGAARLTALRIKKTLSQLSQQEGIKM DIP protein P36897-1 original sequence version: 161 lrg1-acvrl1-1 3 35 unspecified role unspecified role prey prey human Homo sapiens Human 30 unspecified role unspecified role bait bait human Homo sapiens Human physical association physical association eng-lrg1-1 4 32 unspecified role unspecified role bait bait human Homo sapiens Human 30 unspecified role unspecified role prey prey human Homo sapiens Human direct interaction direct interaction tgfbr2-lrg1-1 2 34 unspecified role unspecified role prey prey mouse Mus musculus Mouse 28 unspecified role unspecified role bait bait mouse Mus musculus Mouse physical association physical association lrg1-tgfbr2-1 20 29 unspecified role unspecified role prey prey Extracellular domain Region 23-184 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain Myc-tag Myc-tag myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined human Homo sapiens Human 30 unspecified role unspecified role bait bait human Homo sapiens Human direct interaction direct interaction acvrl1-lrg1-1 16 33 unspecified role unspecified role bait bait mouse Mus musculus Mouse 34 unspecified role unspecified role prey prey mouse Mus musculus Mouse physical association physical association tgfbr1-lrg1-1 18 29 unspecified role unspecified role prey prey Extracellular domain Region 23-184 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain human Homo sapiens Human 36 unspecified role unspecified role bait bait Extracellular domain Region 34-126 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain human Homo sapiens Human 30 unspecified role unspecified role prey prey human Homo sapiens Human association association lrg1-tgfbr1-1 14 27 unspecified role unspecified role prey prey human Homo sapiens Human 30 unspecified role unspecified role bait bait human Homo sapiens Human physical association physical association tgfbr1-eng-1 13 29 unspecified role unspecified role prey prey Extracellular domain Region 23-184 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain human Homo sapiens Human 32 unspecified role unspecified role prey prey Extracellular domain Region 26-586 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain human Homo sapiens Human 36 unspecified role unspecified role bait bait Extracellular domain Region 34-126 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain human Homo sapiens Human 30 unspecified role unspecified role prey prey human Homo sapiens Human association association lrg1-tgfbr1-2 22 36 unspecified role unspecified role prey prey Extracellular domain Region 34-126 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain human Homo sapiens Human 30 unspecified role unspecified role bait bait human Homo sapiens Human direct interaction direct interaction acvrl1-eng-1 19 35 unspecified role unspecified role bait bait Extracellular domain Region 22-118 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain human Homo sapiens Human 29 unspecified role unspecified role prey prey Extracellular domain Region 23-184 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain human Homo sapiens Human 32 unspecified role unspecified role prey prey Extracellular domain Region 26-586 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain human Homo sapiens Human 30 unspecified role unspecified role prey prey human Homo sapiens Human association association lrg1-eng-1 21 32 unspecified role unspecified role prey prey human Homo sapiens Human 30 unspecified role unspecified role bait bait human Homo sapiens Human direct interaction direct interaction lrg1-eng-2 10 24 unspecified role unspecified role prey prey human Homo sapiens Human 30 unspecified role unspecified role bait bait human Homo sapiens Human physical association physical association tgfbr1-lrg1-2 15 25 unspecified role unspecified role bait bait mouse Mus musculus Mouse 34 unspecified role unspecified role prey prey mouse Mus musculus Mouse physical association physical association tgfbr1-eng-2 5 32 unspecified role unspecified role prey prey Extracellular domain Region 26-586 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain human Homo sapiens Human 36 unspecified role unspecified role bait bait Extracellular domain Region 34-126 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain human Homo sapiens Human 30 unspecified role unspecified role prey prey human Homo sapiens Human association association acvrl1-eng-2 11 35 unspecified role unspecified role bait bait Extracellular domain Region 22-118 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain human Homo sapiens Human 32 unspecified role unspecified role prey prey Extracellular domain Region 26-586 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain human Homo sapiens Human 30 unspecified role unspecified role prey prey human Homo sapiens Human association association eng-lrg1-2 6 31 unspecified role unspecified role bait bait mouse Mus musculus Mouse 34 unspecified role unspecified role prey prey mouse Mus musculus Mouse physical association physical association lrg1-tgfbr2-2 7 26 unspecified role unspecified role prey prey human Homo sapiens Human 30 unspecified role unspecified role bait bait human Homo sapiens Human physical association physical association lrg1-tgfbr1-3 1 36 unspecified role unspecified role prey prey Extracellular domain Region 34-126 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain HA-tag HA-tag ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined human Homo sapiens Human 30 unspecified role unspecified role bait bait human Homo sapiens Human direct interaction direct interaction lrg1-eng-3 23 32 unspecified role unspecified role prey prey V5-tag V5-tag v5 tag v5 tag GKPIPNPLLGLDST epitope tag GKPIPNPLLGLDST epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined human Homo sapiens Human 30 unspecified role unspecified role bait bait human Homo sapiens Human direct interaction direct interaction lrg1-eng-4 9 32 unspecified role unspecified role prey prey Extracellular domain Region 26-586 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain ecolx Escherichia coli 30 unspecified role unspecified role bait bait human Homo sapiens Human direct interaction direct interaction tgfbr1-lrg1-3 17 36 unspecified role unspecified role bait bait Extracellular domain Region 34-126 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain human Homo sapiens Human 30 unspecified role unspecified role prey prey human Homo sapiens Human direct interaction direct interaction tgfbr2-lrg1-2 12 29 unspecified role unspecified role bait bait Extracellular domain Region 23-184 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain human Homo sapiens Human 30 unspecified role unspecified role prey prey human Homo sapiens Human direct interaction direct interaction lrg1-tgfbr2-3 8 29 unspecified role unspecified role prey prey Extracellular domain Region 23-184 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain human Homo sapiens Human 30 unspecified role unspecified role bait bait human Homo sapiens Human direct interaction direct interaction