DIP Database of Interacting Proteins 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ dip@mbi.ucla.edu The asymmetric structure of an icosahedral virus bound to its receptor suggests a mechanism for genome release. The asymmetric structure of an icosahedral virus bound to its receptor suggests a mechanism for genome release. Structure (London, England : 1993) 2013 imex curation Dent KC., Thompson R., Barker AM., Hiscox JA., Barr JN., Stockley PG., Ranson NA. Only protein-protein interactions ecolx Escherichia coli 3d-em 3D electron microscopy 3D-EM electron tomog predetermined predetermined participant predetermined Dent KC., Thompson R., Barker AM., Hiscox JA., Barr JN., Stockley PG., Ranson NA. DIP original experiment: DIP-255710X Structure (London, England : 1993) 2013 IMEx The asymmetric structure of an icosahedral virus bound to its receptor suggests a mechanism for genome release. capsd_bpms2 Capsid protein Coat protein protein protein bpms2 Enterobacteria phage MS2 MASNFTQFVLVDNGGTGDVTVAPSNFANGVAEWISSNSRSQAYKVTCSVRQSSAQNRKYTIKVEVPKVATQTVGGVELPVAAWRSYLNMELTIPIFATNSDCELIVKAMQGLLKDGNPIPSAIAANSGIY DIP protein P03612 original sequence version: 94 ABCDD9FD8B188C6A capsd_bpms2-1 1 2 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli direct interaction direct interaction