IntAct European Bioinformatics Institute IntAct intact http://www.ebi.ac.uk/ http://www.ebi.ac.uk/intact/query/${ac} EBI-[0-9]+|IA:[0-9]+ INTerAction database (IntAct) provides an open source database and toolkit for the storage, presentation and analysis of molecular interactions. http://www.ebi.ac.uk/intact European Bioinformatics Institute; Wellcome Trust Genome Campus; Hinxton, Cambridge; CB10 1SD; United Kingdom http://www.ebi.ac.uk/intact/ The yeast dynein Dyn2-Pac11 complex is a dynein dimerization/processivity factor: structural and single-molecule characterization. The yeast dynein Dyn2-Pac11 complex is a dynein dimerization/processivity factor: structural and single-molecule characterization. Molecular biology of the cell 2013 imex curation Rao L., Romes EM., Nicholas MP., Brenner S., Tripathy A., Gennerich A., Slep KC. arne.gennerich@einstein.yu.edu, kslep@bio.unc.edu 05-Sep-2017: Contacted by IntAct-Help. Only protein-protein interactions imex curation in vitro In vitro molecular sieving molecular sieving Gel Filtration Size Exclusion Chromatography Size Exclusion Chromatography Gel Filtration Sizing column predetermined predetermined participant predetermined Rao L., Romes EM., Nicholas MP., Brenner S., Tripathy A., Gennerich A., Slep KC. arne.gennerich@einstein.yu.edu, kslep@bio.unc.edu Accepted 2017-AUG-07 AT 10:24 BST AT 10:24 BST by MGT Molecular biology of the cell 2013 Only protein-protein interactions imex curation imex curation The yeast dynein Dyn2-Pac11 complex is a dynein dimerization/processivity factor: structural and single-molecule characterization. The yeast dynein Dyn2-Pac11 complex is a dynein dimerization/processivity factor: structural and single-molecule characterization. Molecular biology of the cell 2013 imex curation Rao L., Romes EM., Nicholas MP., Brenner S., Tripathy A., Gennerich A., Slep KC. arne.gennerich@einstein.yu.edu, kslep@bio.unc.edu 05-Sep-2017: Contacted by IntAct-Help. Only protein-protein interactions imex curation in vitro In vitro x-ray diffraction x-ray crystallography X-ray X-ray x-ray diffraction predetermined predetermined participant predetermined Rao L., Romes EM., Nicholas MP., Brenner S., Tripathy A., Gennerich A., Slep KC. arne.gennerich@einstein.yu.edu, kslep@bio.unc.edu Accepted 2017-AUG-07 AT 10:24 BST AT 10:24 BST by MGT Molecular biology of the cell 2013 Only protein-protein interactions imex curation imex curation The yeast dynein Dyn2-Pac11 complex is a dynein dimerization/processivity factor: structural and single-molecule characterization. The yeast dynein Dyn2-Pac11 complex is a dynein dimerization/processivity factor: structural and single-molecule characterization. Molecular biology of the cell 2013 imex curation Rao L., Romes EM., Nicholas MP., Brenner S., Tripathy A., Gennerich A., Slep KC. arne.gennerich@einstein.yu.edu, kslep@bio.unc.edu 05-Sep-2017: Contacted by IntAct-Help. Only protein-protein interactions imex curation yeast Saccharomyces cerevisiae Baker's yeast fluorescence imaging fluorescence microscopy fluorescence imaging immunocytochemistry immunocytochemistry Rao L., Romes EM., Nicholas MP., Brenner S., Tripathy A., Gennerich A., Slep KC. arne.gennerich@einstein.yu.edu, kslep@bio.unc.edu Accepted 2017-AUG-07 AT 10:24 BST AT 10:24 BST by MGT Molecular biology of the cell 2013 Only protein-protein interactions imex curation imex curation The yeast dynein Dyn2-Pac11 complex is a dynein dimerization/processivity factor: structural and single-molecule characterization. The yeast dynein Dyn2-Pac11 complex is a dynein dimerization/processivity factor: structural and single-molecule characterization. Molecular biology of the cell 2013 imex curation Rao L., Romes EM., Nicholas MP., Brenner S., Tripathy A., Gennerich A., Slep KC. arne.gennerich@einstein.yu.edu, kslep@bio.unc.edu 05-Sep-2017: Contacted by IntAct-Help. Only protein-protein interactions imex curation yeast Saccharomyces cerevisiae Baker's yeast anti tag coip anti tag coimmunoprecipitation anti tag coip western blot western blot Immuno blot Immuno blot Rao L., Romes EM., Nicholas MP., Brenner S., Tripathy A., Gennerich A., Slep KC. arne.gennerich@einstein.yu.edu, kslep@bio.unc.edu Accepted 2017-AUG-07 AT 10:24 BST AT 10:24 BST by MGT Molecular biology of the cell 2013 Only protein-protein interactions imex curation imex curation The yeast dynein Dyn2-Pac11 complex is a dynein dimerization/processivity factor: structural and single-molecule characterization. The yeast dynein Dyn2-Pac11 complex is a dynein dimerization/processivity factor: structural and single-molecule characterization. Molecular biology of the cell 2013 imex curation Rao L., Romes EM., Nicholas MP., Brenner S., Tripathy A., Gennerich A., Slep KC. arne.gennerich@einstein.yu.edu, kslep@bio.unc.edu 05-Sep-2017: Contacted by IntAct-Help. Only protein-protein interactions imex curation in vitro In vitro itc isothermal titration calorimetry ITC ITC itc predetermined predetermined participant predetermined Rao L., Romes EM., Nicholas MP., Brenner S., Tripathy A., Gennerich A., Slep KC. arne.gennerich@einstein.yu.edu, kslep@bio.unc.edu Accepted 2017-AUG-07 AT 10:24 BST AT 10:24 BST by MGT Molecular biology of the cell 2013 Only protein-protein interactions imex curation imex curation pac11_yeast WD repeat-containing protein PAC11 PAC11 YDR488C protein protein yeast Saccharomyces cerevisiae Baker's yeast MERLKQLEEKRRQLKELRERRKQASLFPGSETMGHHPTEVHAKATMVSVSVQTDMEEGSKIQEPQSAYLRRKEVITYDKGIQTDQIEEEQLQENENHTTTDAVAIETTAADENNKDKAENDQPRLELAKPFLVEEAAATLSNASFARLETEVSASGQQAPSNMQQDKDNLMQWNMVSENLQSETDCDCIAQEYDPGKGVLVVVYLRLPPADLQYASSEAAWSVVNVVKCDNASGRNGLLIDMVEFRGTRIMTATILRRYHPESNVISILLATLTGKIILYELRLKQKKPETPVVYVVQRNMVARHYFQHPVVAVIETSSVQDQERVLVAADNGNIMELSCLDLTVLRKPQQLRPVPLSQLLSLENDTCTYTERLQRLAKFDEVGIACMAYTSEDPQYVWIGGEDGGIYKVFWDQPGPLYLSLDNNGFQPAENHSTRVTGLEFHWDDARRLMLLLSCSTDWTVRLWDARAGKAIIGAPLLLGGPVLRARWLEKNNGGENSRTLRCQVWCADGRLVVVNWAFDAKTSLYTATVIS 2037021799414E9A 2037021799414E9A dyl1_yeast Dynein light chain 1, cytoplasmic DYN2 SLC1 YDR424C protein protein yeast Saccharomyces cerevisiae Baker's yeast MSDENKSTPIVKASDITDKLKEDILTISKDALDKYQLERDIAGTVKKQLDVKYGNTWHVIVGKNFGSYVTHEKGHFVYFYIGPLAFLVFKTA C25A690F35C3CEEC C25A690F35C3CEEC dyhc_yeast Dynein heavy chain, cytoplasmic DYN1 DHC1 Dynein heavy chain, cytosolic YKR054C protein protein yeast Saccharomyces cerevisiae Baker's yeast MCKNEARLANELIEFVAATVTGIKNSPKENEQAFIDYLHCQYLERFQFFLGLLDGREFDTLFVFLFEELDRTIVTIDIGEEAIYDANLANKKYSTLLIIKSRSVIVDAEPIATQISAIYLPGPVNAGNLASIITHGVSSVFGQLIKSDTKTYSVETIDKTRRKLDDISKQFQQLHTSIETPDLLAMVPSIIKLAVSKGATSHDYANYLPSNDLESMRFLNILQSIANKWFLVLKQTLAIDRDIKNGSFLDEVEFWSNFYEVLKSLIEQTQSQEFQVCLSVLTNAKRFHNLTNLLNEGSLSDKFKLADKYNQFLSSIPIDEVRQASNLEDLQELFPVLASSLKKFRYSGYPVQRFVVLMDKISQEVMDAILSNLSDLFQLEYGSFLGLYEKSAGMIEEWDDIVQDVNLLIREDLRKRAPQELLIQKLTFTSASVKATLDEILSTRKRFFSLAETIKSISPSTYHEEIQRLYHPFEQIHDISVNFRLKLEQAESEFSKNMLDLEKKLQNTLASFMDSDHCPTEKLSYLVKFKPLMELCPRIKVKVLENQQILLLEIKKDIRQLETGLELLPKILHVEALNNIPPISARISYFLNVQSRIDNIVQYLEALFGSNWNDTLEGRSISTSIVQLRKETNPHDVFLHWLGNFPEKATANLLTTPILKLIRNNEDDYELKVNFDFALAAAYSELRSLTYMAFQVPSHIVRIARTYMYLYPRAINLVELIQTFFSLSKSLSYTFYTNIFLKRNVQTVWLLLQQILITPWESLQEESSEMSCSVHSLARLEKSIDGILSDYQILKNSEPQFAKEFSGLKSFDGTADDLHEVEEIISNIQAIFENLFTKGLTNVSDHISTFNNLIISIILEKVRLNLKKMHFPKHVLKLSFNEGRITSSPSLAAMKRSLLKDIEALLNKVVLINFLHDPDHPLSTTLTFNSLVIKLKDDIQNCIEQVQNLHCKINSYVKEWQKMEFLWQITEEAFLEVVDNSTQRCFGILKGLLDSQSKFDLIISRNNFSKNLVLHTEDAQRHIRSKMDSWILYVSKHLLTIYERDARKLHEDMNRDREAVEDMDINFTSLKNITVIIEAVNVNKRHLTERDIQIKLLGSVMRALTKLKVRFPSHFVYIDQLDNDFSSLRQSLSYVEQELQKHRVVIAKSLEEGVENINNLSQSLNESWSVRKPISPTLTPPEALKILEFFNESITKLKKKMHSVAAAAKMLLIPVVLNDQLTHVVEEVKTYDLVWRSIKNLWEDVQRTFETPWCRVDVLLLQSDLANFLRRADELPRAVKQFEMYKSLFSQVNMLTSVNKILVELKDGALKPRHWNMIFRDIGKRQIQKNLLDKLEFSLKDVMVLNLTLNEILLTKIIERAQKEFVIEKSLNRIKKFWKEAQYEVIEHSSGLKLVREWDVLEQACKEDLEELVSMKASNYYKIFEQDCLDLESKLTKLSEIQVNWVEVQFYWLDLYGILGENLDIQNFLPLETSKFKSLTSEYKMITTRAFQLDTTIEVIHIPNFDTTLKLTIDSLKMIKSSLSTFLERQRRQFPRFYFLGNDDLLKIIGSGKHHDQVSKFMKKMFGSIESIIFLEDFITGVRSVEGEVLNLNEKIELKDSIQAQEWLNILDTEIKLSVFTQFRDCLGQLKDGTDIEVVVSKYIFQAILLSAQVMWTELVEKCLQTNQFSKYWKEVDMKIKGLLDKLNKSSDNVKKKIEALLVEYLHFNNVIGQLKNCSTKEEARLLWAKVQKFYQKNDTLDDLNSVFISQSGYLLQYKFEYIGIPERLIYTPLLLIGFATLTDSLHQKYGGCFFGPAGTGKTETVKAFGQNLGRVVVVFNCDDSFDYQVLSRLLVGITQIGAWGCFDEFNRLDEKVLSAVSANIQQIQNGLQVGKSHITLLEEETPLSPHTAVFITLNPGYNGRSELPENLKKSFREFSMKSPQSGTIAEMILQIMGFEDSKSLASKIVHFLELLSSKCSSMNHYHFGLRTLKGVLRNCSPLISEFGEGEKTVVESLKRVILPSLGDTDELVFKDELSKIFDSAGTPLNSKAIVQCLKDAGQRSGFSMSEEFLKKCMQFYYMQKTQQALILVGKAGCGKTATWKTVIDAMAIFDGHANVVYVIDTKVLTKESLYGSMLKATLEWRDGLFTSILRRVNDDITGTFKNSRIWVVFDSDLDPEYVEAMNSVLDDNKILTLPNGERLPIPPNFRILFETDNLDHTTPATITRCGLLWFSTDVCSISSKIDHLLNKSYEALDNKLSMFELDKLKDLISDSFDMASLTNIFTCSNDLVHILGVRTFNKLETAVQLAVHLISSYRQWFQNLDDKSLKDVITLLIKRSLLYALAGDSTGESQRAFIQTINTYFGHDSQELSDYSTIVIANDKLSFSSFCSEIPSVSLEAHEVMRPDIVIPTIDTIKHEKIFYDLLNSKRGIILCGPPGSGKTMIMNNALRNSSLYDVVGINFSKDTTTEHILSALHRHTNYVTTSKGLTLLPKSDIKNLVLFCDEINLPKLDKYGSQNVVLFLRQLMEKQGFWKTPENKWVTIERIHIVGACNPPTDPGRIPMSERFTRHAAILYLGYPSGKSLSQIYEIYYKAIFKLVPEFRSYTEPFARASVHLYNECKARYSTGLQSHYLFSPRELTRLVRGVYTAINTGPRQTLRSLIRLWAYEAWRIFADRLVGVKEKNSFEQLLYETVDKYLPNQDLGNISSTSLLFSGLLSLDFKEVNKTDLVNFIEERFKTFCDEELEVPMVIHESMVDHILRIDRALKQVQGHMMLIGASRTGKTILTRFVAWLNGLKIVQPKIHRHSNLSDFDMILKKAISDCSLKESRTCLIIDESNILETAFLERMNTLLANADIPDLFQGEEYDKLLNNLRNKTRSLGLLLDTEQELYDWFVGEIAKNLHVVFTICDPTNNKSSAMISSPALFNRCIINWMGDWDTKTMSQVANNMVDVIPMEFTDFIVPEVNKELVFTEPIQTIRDAVVNILIHFDRNFYQKMKVGVNPRSPGYFIDGLRALVKLVTAKYQDLQENQRFVNVGLEKLNESVLKVNELNKTLSKKSTELTEKEKEARSTLDKMLMEQNESERKQEATEEIKKILKVQEEDIRKRKEVVMKSIQDIEPTILEAQRGVKNIKKQQLTEIRSMVNPPSGVKIVMEAVCAILGYQFSNWRDIQQFIRKDDFIHNIVHYDTTLHMKPQIRKYMEEEFLSDPNFTYETINRASKACGPLYQWVNAQINFSKVLENVDPLRQEMKRIEFESLKTKANLLAAEEMTQDLEASIEVSKRKYSLLIRDVEAIKTEMSNVQANLDRSISLVKSLTFEKERWLNTTKQFSKTSQELIGNCIISSIYETYFGHLNERERADMLVILKRLLGKFAVKYDVNYRFIDYLVTLDEKMKWLECGLDKNDYFLENMSIVMNSQDAVPFLLDPSSHMITVISNYYGNKTVLLSFLEEGFVKRLENAIRFGSVVIIQDGEFFDPIISRLISREFNHAGNRVTVEIGDHEVDVSGDFKLFIHSCDPSGDIPIFLRSRVRLVHFVTNKESIETRIFDITLTEENAEMQRKREDLIKLNTEYKLKLKNLEKRLLEELNNSQGNMLENDELMVTLNNLKKEAMNIEKKLSESEEFFPQFDNLVEEYSIIGKHSVKIFSMLEKFGQFHWFYGISIGQFLSCFKRVFIKKSRETRAARTRVDEILWLLYQEVYCQFSTALDKKFKMIMAMTMFCLYKFDIESEQYKEAVLTMIGVLSESSDGVPKLTVDTNNDLRYLWDYVTTKSYISALNWFKNEFFVDEWNIADVVANSENNYFTMASERDVDGTFKLIELAKASKESLKIIPLGSIENLNYAQEEISKSKIEGGWILLQNIQMSLSWVKTYLHKHVEETKAAEEHEKFKMFMTCHLTGDKLPAPLLQRTDRFVYEDIPGILDTVKDLWGSQFFTGKISGVWSVYCTFLLSWFHALITARTRLVPHGFSKKYYFNDCDFQFASVYLENVLATNSTNNIPWAQVRDHIATIVYGGKIDEEKDLEVVAKLCAHVFCGSDNLQIVPGVRIPQPLLQQSEEEERARLTAILSNTIEPADSLSSWLQLPRESILNYERLQAKEVASSTEQLLQEM 3D9DF447E8E2D6BB dyn2-pac11-2 5 7 unspecified role unspecified role neutral component neutral component Q02647:p.[Phe76Lys;Tyr78Glu] mutation disrupting strength mutation disrupting interaction strength mutation disrupting strength certain certain sequence position certain certain certain sequence position certain F K certain certain sequence position certain certain certain sequence position certain Y E Wed May 02 15:17:37 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'phe76lys,tyr78glu' Tue Jun 30 19:17:14 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.[Phe76Lys;Tyr78Glu]' Q02647:p.His58Lys mutation disrupting strength mutation disrupting interaction strength mutation disrupting strength certain certain sequence position certain certain certain sequence position certain H K Wed May 02 15:41:31 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'his58lys' Tue Jun 30 17:37:34 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.His58Lys' ecoli Escherichia coli (strain K12) 6 unspecified role unspecified role neutral component neutral component region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain chemical synthesis Chemical synthesis (Chemical synthesis) direct interaction direct interaction Fig. 1C, 5C, 5E, Supp fig 3 dyn2-pac11-3 2 7 unspecified role unspecified role neutral component neutral component ecoli Escherichia coli (strain K12) 6 unspecified role unspecified role neutral component neutral component region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain chemical synthesis Chemical synthesis (Chemical synthesis) direct interaction direct interaction Table 1 1.9A Rworking 0.16 Rfree 0.212 dyn2-1 1 7 unspecified role unspecified role neutral component neutral component Q02647:p.[Phe76Lys;Tyr78Glu] mutation with no effect mutation with no effect mutation with no effect mutation not affecting interaction certain certain sequence position certain certain certain sequence position certain F K certain certain sequence position certain certain certain sequence position certain Y E Wed May 02 15:58:33 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'phe76lys,tyr78glu' Tue Jun 30 19:25:16 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.[Phe76Lys;Tyr78Glu]' Q02647:p.His58Lys mutation disrupting strength mutation disrupting interaction strength mutation disrupting strength certain certain sequence position certain certain certain sequence position certain H K Wed May 02 18:58:13 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'his58lys' Tue Jun 30 19:07:43 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.His58Lys' yeast Saccharomyces cerevisiae Baker's yeast direct interaction direct interaction Fig. 5B, supp fig S2 dyn1-dyn2-1 4 6 unspecified role unspecified role prey prey region myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 7 unspecified role unspecified role prey prey 8 unspecified role unspecified role bait bait n-terminal zz tag zz tag ZZ tag ZZ tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range n-terminal gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range n-terminal ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range c-terminal halotag tag tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range association association Fig. 7A dyn1-pac11-1 4 6 unspecified role unspecified role prey prey region myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 8 unspecified role unspecified role bait bait n-terminal zz tag zz tag ZZ tag ZZ tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range n-terminal gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range n-terminal ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range c-terminal halotag tag tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range physical association physical association Fig. 7A Interaction observed in DYN2-/- cells dyn1-pac11-2 3 6 unspecified role unspecified role neutral component neutral component region myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 8 tag fluorescence tag visualisation by fluorescence tag fluorescence immunocytochemistry immunocytochemistry unspecified role unspecified role neutral component neutral component n-terminal gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range n-terminal ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range c-terminal halotag tag tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range c-terminal tetramethyl rhodamine label tetramethyl rhodamine label c-term range C-terminal range c-term range c-term range C-terminal range c-term range 7 unspecified role unspecified role ancillary ancillary colocalization colocalization Fig. 7B, Supp fig 4 TMR labelling of HALO tag. Colocalization is not observed in the absence of DYN2