DIP Database of Interacting Proteins 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ dip@mbi.ucla.edu Proteomic and genomic approaches reveal critical functions of H3K9 methylation and heterochromatin protein-1γ in reprogramming to pluripotency. Proteomic and genomic approaches reveal critical functions of H3K9 methylation and heterochromatin protein-1γ in reprogramming to pluripotency. Nature cell biology 2013 imex curation Sridharan R., Gonzales-Cope M., Chronis C., Bonora G., McKee R., Huang C., Patel S., Lopez D., Mishra N., Pellegrini M., Carey M., Garcia BA., Plath K. Only protein-protein interactions mouse Mus musculus Mouse anti tag coip anti tag coimmunoprecipitation anti tag coip western blot western blot Immuno blot Immuno blot Sridharan R., Gonzales-Cope M., Chronis C., Bonora G., McKee R., Huang C., Patel S., Lopez D., Mishra N., Pellegrini M., Carey M., Garcia BA., Plath K. DIP original experiment: DIP-259896X Nature cell biology 2013 IMEx Proteomic and genomic approaches reveal critical functions of H3K9 methylation and heterochromatin protein-1γ in reprogramming to pluripotency. med29_mouse Mediator of RNA polymerase II transcription subunit 29 Med29 Ixl Intersex-like protein Mediator complex subunit 29 protein protein mouse Mus musculus Mouse MAAPQPQAAAVSSASGVSGPGSAGGPGPQQQPQPTQLVGSAQSGLLQQQQQDFDPVQRYKMLIPQLKESLQTLMKVAAQNLIQNTNIDNGQKSSDAPLQRFDKCLEEFYALCDQLELCLRLAHECLSQSCDSAKHSPTLVPTATKPDAVQPDSLPYPQYLAVIKAQITCAKDIHTALLDCANKVTGKTTAPSTGPGGSL DIP protein Q9DB91 original sequence version: 87 60C50BE919D5A2C1 med6_mouse Mediator of RNA polymerase II transcription subunit 6 Med6 Mediator complex subunit 6 protein protein mouse Mus musculus Mouse MAAVDIRDNLLGISWVDSSWIPILNSGSVLDYFSERSNPFYDRTCNNEVVKMQRLTLEHLNQMVGIEYILLHAQEPILFIIRKQQRQSPAQVIPLADYYIIAGVIYQAPDLGSVINSRVLTAVHGIQSAFDEAMSYCRYHPSKGYWWHFKDHEEQEKVKPKAKRKEEPSSIFQRQRVDALLIDLRQKFPPRFVQQKSGEKPVPVDQAKKEAEPLPETVKSEEKESTKNIQQTVSTKGPPEKRMRLQ DIP protein Q921D4 original sequence version: 78 51DB8A599B24DCF6 cbx3_mouse Chromobox protein homolog 3 Cbx3 Heterochromatin protein 1 homolog gamma Modifier 2 protein M32 protein protein mouse Mus musculus Mouse MASNKTTLQKMGKKQNGKSKKVEEAEPEEFVVEKVLDRRVVNGKVEYFLKWKGFTDADNTWEPEENLDCPELIEDFLNSQKAGKEKDGTKRKSLSDSESDDSKSKKKRDAADKPRGFARGLDPERIIGATDSSGELMFLMKWKDSDEADLVLAKEANMKCPQIVIAFYEERLTWHSCPEDEAQ DIP protein P23198 original sequence version: 123 DIP protein P23198 original sequence version: 121 DIP protein P23198 original sequence version: 111 2FF3AD53B883E27E med29-cbx3-1 1 3 unspecified role unspecified role prey prey mouse Mus musculus Mouse 4 unspecified role unspecified role prey prey mouse Mus musculus Mouse 2 unspecified role unspecified role bait bait Flag-tag Flag-tag flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged n-term range n-terminal range n-term range n-term range n-terminal range n-term range mouse Mus musculus Mouse association association