DIP Database of Interacting Proteins 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ dip@mbi.ucla.edu Structural insights into the functions of TBK1 in innate antimicrobial immunity. Structural insights into the functions of TBK1 in innate antimicrobial immunity. Structure (London, England : 1993) 2013 imex curation Shu C., Sankaran B., Chaton CT., Herr AB., Mishra A., Peng J., Li P. Only protein-protein interactions in vitro In vitro protein kinase assay protein kinase assay weight autoradiogra molecular weight estimation by autoradiography weight autoradiogra Shu C., Sankaran B., Chaton CT., Herr AB., Mishra A., Peng J., Li P. DIP original experiment: DIP-253960X Structure (London, England : 1993) 2013 IMEx Structural insights into the functions of TBK1 in innate antimicrobial immunity. Structural insights into the functions of TBK1 in innate antimicrobial immunity. Structural insights into the functions of TBK1 in innate antimicrobial immunity. Structure (London, England : 1993) 2013 imex curation Shu C., Sankaran B., Chaton CT., Herr AB., Mishra A., Peng J., Li P. Only protein-protein interactions in vitro In vitro pull down pull down weight by comassie molecular weight estimation by coomasie staining weight by comassie Shu C., Sankaran B., Chaton CT., Herr AB., Mishra A., Peng J., Li P. DIP original experiment: DIP-253961X Structure (London, England : 1993) 2013 IMEx Structural insights into the functions of TBK1 in innate antimicrobial immunity. Structural insights into the functions of TBK1 in innate antimicrobial immunity. Structural insights into the functions of TBK1 in innate antimicrobial immunity. Structure (London, England : 1993) 2013 imex curation Shu C., Sankaran B., Chaton CT., Herr AB., Mishra A., Peng J., Li P. Only protein-protein interactions in vitro In vitro protein kinase assay protein kinase assay weight autoradiogra molecular weight estimation by autoradiography weight autoradiogra Shu C., Sankaran B., Chaton CT., Herr AB., Mishra A., Peng J., Li P. DIP original experiment: DIP-253958X Structure (London, England : 1993) 2013 IMEx Structural insights into the functions of TBK1 in innate antimicrobial immunity. Structural insights into the functions of TBK1 in innate antimicrobial immunity. Structural insights into the functions of TBK1 in innate antimicrobial immunity. Structure (London, England : 1993) 2013 imex curation Shu C., Sankaran B., Chaton CT., Herr AB., Mishra A., Peng J., Li P. Only protein-protein interactions spofr Spodoptera frugiperda (Fall armyworm) Fall armyworm x-ray diffraction x-ray crystallography X-ray X-ray x-ray diffraction predetermined predetermined participant predetermined Shu C., Sankaran B., Chaton CT., Herr AB., Mishra A., Peng J., Li P. DIP original experiment: DIP-253957X Structure (London, England : 1993) 2013 IMEx Structural insights into the functions of TBK1 in innate antimicrobial immunity. Structural insights into the functions of TBK1 in innate antimicrobial immunity. Structural insights into the functions of TBK1 in innate antimicrobial immunity. Structure (London, England : 1993) 2013 imex curation Shu C., Sankaran B., Chaton CT., Herr AB., Mishra A., Peng J., Li P. Only protein-protein interactions spofr Spodoptera frugiperda (Fall armyworm) Fall armyworm molecular sieving molecular sieving Gel Filtration Size Exclusion Chromatography Size Exclusion Chromatography Gel Filtration Sizing column predetermined predetermined participant predetermined Shu C., Sankaran B., Chaton CT., Herr AB., Mishra A., Peng J., Li P. DIP original experiment: DIP-253956X Structure (London, England : 1993) 2013 IMEx Structural insights into the functions of TBK1 in innate antimicrobial immunity. Structural insights into the functions of TBK1 in innate antimicrobial immunity. Structural insights into the functions of TBK1 in innate antimicrobial immunity. Structure (London, England : 1993) 2013 imex curation Shu C., Sankaran B., Chaton CT., Herr AB., Mishra A., Peng J., Li P. Only protein-protein interactions in vitro In vitro protein kinase assay protein kinase assay predetermined predetermined participant predetermined Shu C., Sankaran B., Chaton CT., Herr AB., Mishra A., Peng J., Li P. DIP original experiment: DIP-253959X Structure (London, England : 1993) 2013 IMEx Structural insights into the functions of TBK1 in innate antimicrobial immunity. Structural insights into the functions of TBK1 in innate antimicrobial immunity. Structural insights into the functions of TBK1 in innate antimicrobial immunity. Structure (London, England : 1993) 2013 imex curation Shu C., Sankaran B., Chaton CT., Herr AB., Mishra A., Peng J., Li P. Only protein-protein interactions in vitro In vitro molecular sieving molecular sieving Gel Filtration Size Exclusion Chromatography Size Exclusion Chromatography Gel Filtration Sizing column predetermined predetermined participant predetermined Shu C., Sankaran B., Chaton CT., Herr AB., Mishra A., Peng J., Li P. DIP original experiment: DIP-253962X Structure (London, England : 1993) 2013 IMEx Structural insights into the functions of TBK1 in innate antimicrobial immunity. Structural insights into the functions of TBK1 in innate antimicrobial immunity. Structural insights into the functions of TBK1 in innate antimicrobial immunity. Structure (London, England : 1993) 2013 imex curation Shu C., Sankaran B., Chaton CT., Herr AB., Mishra A., Peng J., Li P. Only protein-protein interactions in vitro In vitro molecular sieving molecular sieving Gel Filtration Size Exclusion Chromatography Size Exclusion Chromatography Gel Filtration Sizing column predetermined predetermined participant predetermined Shu C., Sankaran B., Chaton CT., Herr AB., Mishra A., Peng J., Li P. DIP original experiment: DIP-253964X Structure (London, England : 1993) 2013 IMEx Structural insights into the functions of TBK1 in innate antimicrobial immunity. Structural insights into the functions of TBK1 in innate antimicrobial immunity. Structural insights into the functions of TBK1 in innate antimicrobial immunity. Structure (London, England : 1993) 2013 imex curation Shu C., Sankaran B., Chaton CT., Herr AB., Mishra A., Peng J., Li P. Only protein-protein interactions in vitro In vitro solution sedimentati cosedimentation in solution solution sedimentati predetermined predetermined participant predetermined Shu C., Sankaran B., Chaton CT., Herr AB., Mishra A., Peng J., Li P. DIP original experiment: DIP-253963X Structure (London, England : 1993) 2013 IMEx Structural insights into the functions of TBK1 in innate antimicrobial immunity. cbp_human CREB-binding protein CREBBP CBP Histone lysine acetyltransferase CREBBP Protein-lysine acetyltransferase CREBBP protein protein human Homo sapiens Human MAENLLDGPPNPKRAKLSSPGFSANDSTDFGSLFDLENDLPDELIPNGGELGLLNSGNLVPDAASKHKQLSELLRGGSGSSINPGIGNVSASSPVQQGLGGQAQGQPNSANMASLSAMGKSPLSQGDSSAPSLPKQAASTSGPTPAASQALNPQAQKQVGLATSSPATSQTGPGICMNANFNQTHPGLLNSNSGHSLINQASQGQAQVMNGSLGAAGRGRGAGMPYPTPAMQGASSSVLAETLTQVSPQMTGHAGLNTAQAGGMAKMGITGNTSPFGQPFSQAGGQPMGATGVNPQLASKQSMVNSLPTFPTDIKNTSVTNVPNMSQMQTSVGIVPTQAIATGPTADPEKRKLIQQQLVLLLHAHKCQRREQANGEVRACSLPHCRTMKNVLNHMTHCQAGKACQVAHCASSRQIISHWKNCTRHDCPVCLPLKNASDKRNQQTILGSPASGIQNTIGSVGTGQQNATSLSNPNPIDPSSMQRAYAALGLPYMNQPQTQLQPQVPGQQPAQPQTHQQMRTLNPLGNNPMNIPAGGITTDQQPPNLISESALPTSLGATNPLMNDGSNSGNIGTLSTIPTAAPPSSTGVRKGWHEHVTQDLRSHLVHKLVQAIFPTPDPAALKDRRMENLVAYAKKVEGDMYESANSRDEYYHLLAEKIYKIQKELEEKRRSRLHKQGILGNQPALPAPGAQPPVIPQAQPVRPPNGPLSLPVNRMQVSQGMNSFNPMSLGNVQLPQAPMGPRAASPMNHSVQMNSMGSVPGMAISPSRMPQPPNMMGAHTNNMMAQAPAQSQFLPQNQFPSSSGAMSVGMGQPPAQTGVSQGQVPGAALPNPLNMLGPQASQLPCPPVTQSPLHPTPPPASTAAGMPSLQHTTPPGMTPPQPAAPTQPSTPVSSSGQTPTPTPGSVPSATQTQSTPTVQAAAQAQVTPQPQTPVQPPSVATPQSSQQQPTPVHAQPPGTPLSQAAASIDNRVPTPSSVASAETNSQQPGPDVPVLEMKTETQAEDTEPDPGESKGEPRSEMMEEDLQGASQVKEETDIAEQKSEPMEVDEKKPEVKVEVKEEEESSSNGTASQSTSPSQPRKKIFKPEELRQALMPTLEALYRQDPESLPFRQPVDPQLLGIPDYFDIVKNPMDLSTIKRKLDTGQYQEPWQYVDDVWLMFNNAWLYNRKTSRVYKFCSKLAEVFEQEIDPVMQSLGYCCGRKYEFSPQTLCCYGKQLCTIPRDAAYYSYQNRYHFCEKCFTEIQGENVTLGDDPSQPQTTISKDQFEKKKNDTLDPEPFVDCKECGRKMHQICVLHYDIIWPSGFVCDNCLKKTGRPRKENKFSAKRLQTTRLGNHLEDRVNKFLRRQNHPEAGEVFVRVVASSDKTVEVKPGMKSRFVDSGEMSESFPYRTKALFAFEEIDGVDVCFFGMHVQEYGSDCPPPNTRRVYISYLDSIHFFRPRCLRTAVYHEILIGYLEYVKKLGYVTGHIWACPPSEGDDYIFHCHPPDQKIPKPKRLQEWYKKMLDKAFAERIIHDYKDIFKQATEDRLTSAKELPYFEGDFWPNVLEESIKELEQEEEERKKEESTAASETTEGSQGDSKNAKKKNNKKTNKNKSSISRANKKKPSMPNVSNDLSQKLYATMEKHKEVFFVIHLHAGPVINTLPPIVDPDPLLSCDLMDGRDAFLTLARDKHWEFSSLRRSKWSTLCMLVELHTQGQDRFVYTCNECKHHVETRWHCTVCEDYDLCINCYNTKSHAHKMVKWGLGLDDEGSSQGEPQSKSPQESRRLSIQRCIQSLVHACQCRNANCSLPSCQKMKRVVQHTKGCKRKTNGGCPVCKQLIALCCYHAKHCQENKCPVPFCLNIKHKLRQQQIQHRLQQAQLMRRRMATMNTRNVPQQSLPSPTSAPPGTPTQQPSTPQTPQPPAQPQPSPVSMSPAGFPSVARTQPPTTVSTGKPTSQVPAPPPPAQPPPAAVEAARQIEREAQQQQHLYRVNINNSMPPGRTGMGTPGSQMAPVSLNVPRPNQVSGPVMPSMPPGQWQQAPLPQQQPMPGLPRPVISMQAQAAVAGPRMPSVQPPRSISPSALQDLLRTLKSPSSPQQQQQVLNILKSNPQLMAAFIKQRTAKYVANQPGMQPQPGLQSQPGMQPQPGMHQQPSLQNLNAMQAGVPRPGVPPQQQAMGGLNPQGQALNIMNPGHNPNMASMNPQYREMLRRQLLQQQQQQQQQQQQQQQQQQGSAGMAGGMAGHGQFQQPQGPGGYPPAMQQQQRMQQHLPLQGSSMGQMAAQMGQLGQMGQPGLGADSTPNIQQALQQRILQQQQMKQQIGSPGQPNPMSPQQHMLSGQPQASHLPGQQIATSLSNQVRSPAPVQSPRPQSQPPHSSPSPRIQPQPSPHHVSPQTGSPHPGLAVTMASSIDQGHLGNPEQSAMLPQLNTPSRSALSSELSLVGDTTGDTLEKFVEGL DIP protein Q92793 original sequence version: 134 DIP protein Q92793-1 original sequence version: 171 DIP protein Q92793 original sequence version: 171 DIP protein Q92793 original sequence version: 185 DIP protein Q92793 original sequence version: 106 DIP protein Q92793 original sequence version: 104 DIP protein Q92793 original sequence version: 112 DIP protein Q92793 original sequence version: 135 DIP protein Q92793 original sequence version: 139 DIP protein Q92793 original sequence version: 157 DIP protein Q92793 original sequence version: 177 DIP protein Q92793 original sequence version: 168 DIP protein Q92793-1 original sequence version: 174 DIP protein Q92793 original sequence version: 146 DIP protein Q92793 original sequence version: 161 DIP protein Q92793 original sequence version: 172 3BEA9B8558BA1A5E tbk1_mouse Serine/threonine-protein kinase TBK1 TANK-binding kinase 1 T2K Tbk1 protein protein mouse Mus musculus Mouse MQSTSNHLWLLSDILGQGATANVFRGRHKKTGDLYAVKVFNNISFLRPVDVQMREFEVLKKLNHKNIVKLFAIEEETTTRHKVLIMEFCPCGSLYTVLEEPSNAYGLPESEFLIVLRDVVGGMNHLRENGIVHRDIKPGNIMRVIGEDGQSVYKLTDFGAARELEDDEQFVSLYGTEEYLHPDMYERAVLRKDHQKKYGATVDLWSVGVTFYHAATGSLPFRPFEGPRRNKEVMYKIITGKPSGAISGVQKAENGPIDWSGDMPLSCSLSQGLQALLTPVLANILEADQEKCWGFDQFFAETSDVLHRMVIHVFSLQHMTAHKIYIHSYNTAAVFHELVYKQTKIVSSNQELIYEGRRLVLELGRLAQHFPKTTEENPIFVTSREQLNTVGLRYEKISLPKIHPRYDLDGDASMAKAVTGVVCYACRTASTLLLYQELMRKGVRWLVELVKDDYNETVHKKTEVVITLDFCIRNIEKTVKVYEKLMKVNLEAAELGEISDIHTKLLRLSSSQGTIESSLQDISSRLSPGGLLADTWAHQEGTHPRDRNVEKLQVLLNCITEIYYQFKKDKAERRLAYNEEQIHKFDKQKLYYHATKAMSHFSEECVRKYEAFKDKSEEWMRKMLHLRKQLLSLTNQCFDIEEEVSKYQDYTNELQETLPQKMLAASGGVKHAMAPIYPSSNTLVEMTLGMKKLKEEMEGVVKELAENNHILERFGSLTMDGGLRNVDCL DIP protein Q9WUN2 original sequence version: 53 DIP protein Q9WUN2 original sequence version: 101 DIP protein Q9WUN2 original sequence version: 100 DIP protein Q9WUN2 original sequence version: 93 978ADDE3061DACD1 irf3_human Interferon regulatory factor 3 IRF3 protein protein human Homo sapiens Human MGTPKPRILPWLVSQLDLGQLEGVAWVNKSRTRFRIPWKHGLRQDAQQEDFGIFQAWAEATGAYVPGRDKPDLPTWKRNFRSALNRKEGLRLAEDRSKDPHDPHKIYEFVNSGVGDFSQPDTSPDTNGGGSTSDTQEDILDELLGNMVLAPLPDPGPPSLAVAPEPCPQPLRSPSLDNPTPFPNLGPSENPLKRLLVPGEEWEFEVTAFYRGRQVFQQTISCPEGLRLVGSEVGDRTLPGWPVTLPDPGMSLTDRGVMSYVRHVLSCLGGGLALWRAGQWLWAQRLGHCHTYWAVSEELLPNSGHGPDGEVPKDKEGGVFDLGPFIVDLITFTEGSGRSPRYALWFCVGESWPQDQPWTKRLVMVKVVPTCLRALVEMARVGGASSLENTVDLHISNSHPLSLTSDQYKAYLQDLVEGMDFQGPGES DIP protein Q14653 original sequence version: 96 DIP protein Q14653 original sequence version: 75 DIP protein Q14653 original sequence version: 95 DIP protein Q14653-1 original sequence version: 128 DIP protein Q14653 original sequence version: 119 F536676FA78B0110 tank_mouse TRAF family member-associated NF-kappa-B activator TRAF-interacting protein Tank Itraf protein protein mouse Mus musculus Mouse MSLKRHSLRRNACHLETRAGIPTILYSDATGQRGMDKNIGEQLNRAYEAFRQACMDRDSAVRELQQKQTENYEQRIREQQEQLSFQQNLIDRLKSQLLLVDSSRDNSYGYVPLLEDSDRRKNNLTLDEPHDKVKLGTLRDKQSKVRRQEVSSGKESAKGLNIPLHHERDNIEKTFWDLKEEFHRICLLAKAQKDHLSKLNIPDIATDTQCSVPIQCTDKTEKQEALFKPQAKDDINRGMSCVTAVTPRGLGRDEEDTSFESLSKFNVKFPPMDNDSIFLHSTPEAPSILAPATPETVCQDRFNMEVRDNPGNFVKTEETLFEIQGIDPITSAIQNLKTTDKTNPSNLRATCLPAGDHNVFYVNTFPLQDPPDAPFPSLDSPGKAVRGPQQPFWKPFLNQDTDLVVPSDSDSELLKPLVCEFCQELFPPSITSRGDFLRHLNTHFNGET DIP protein P70347 original sequence version: 105 313E704C881FB5F3 tbk1-1 5 11 unspecified role unspecified role unspecified role unspecified role Region 1-657 Region 1-657 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain spofr Spodoptera frugiperda (Fall armyworm) Fall armyworm direct interaction direct interaction tbk1-tank-5 2 13 unspecified role unspecified role prey prey ecolx Escherichia coli 11 unspecified role unspecified role bait bait Region 658-729 Region 658-729 required to bind necessary binding region required to bind deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain GST-tag GST-tag gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range spofr Spodoptera frugiperda (Fall armyworm) Fall armyworm direct interaction direct interaction irf3-5 9 12 unspecified role unspecified role unspecified role unspecified role pRes pRes phosres phosphorylated residue PhosRes Phospho Phosphorylation Phosphorylation (O of Serine, Threonine, Tyrosine and Aspartate, N epsilon of Lysine) undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined prerequisite-ptm prerequisite-ptm prerequisite ptm required ptm prerequisite-ptm required-ptm ecolx Escherichia coli direct interaction direct interaction tbk1-tbk1-2 6 11 enzyme enzyme unspecified role unspecified role spofr Spodoptera frugiperda (Fall armyworm) Fall armyworm 11 enzyme target enzyme target substrate substrate unspecified role unspecified role Q9WUN2:p.Ser172Ala S172A mutation disrupting rate mutation disrupting interaction rate mutation disrupting rate alanine scanning alanine scanning certain certain sequence position certain certain certain sequence position certain S A This feature has been corrected as a result of our quality control procedures. The original label was 'S172A'. Wed May 02 19:54:04 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'ser172ala' Tue Jun 30 15:52:55 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Ser172Ala' Region 1-657 Region 1-657 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain Q9WUN2:p.Lys38Ala K38A mutation mutation certain certain sequence position certain certain certain sequence position certain K A This feature has been corrected as a result of our quality control procedures. The original label was 'K38A'. Wed May 02 15:42:39 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'lys38ala' Tue Jun 30 19:21:48 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Lys38Ala' spofr Spodoptera frugiperda (Fall armyworm) Fall armyworm phosphorylation phosphorylation reaction phosphorylation crebbp-irf3-14 8 10 unspecified role unspecified role unspecified role unspecified role Region 2066-2111 Region 2066-2111 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain ecolx Escherichia coli 12 unspecified role unspecified role unspecified role unspecified role Region 189-427 Region 189-427 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain ecolx Escherichia coli direct interaction direct interaction tbk1-7 4 11 unspecified role unspecified role unspecified role unspecified role Region 1-657 Region 1-657 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain spofr Spodoptera frugiperda (Fall armyworm) Fall armyworm direct interaction direct interaction irf3-9 7 12 unspecified role unspecified role unspecified role unspecified role Region 189-427 Region 189-427 sufficient to bind sufficient binding region sufficient to bind deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain pRes pRes phosres phosphorylated residue PhosRes Phospho Phosphorylation Phosphorylation (O of Serine, Threonine, Tyrosine and Aspartate, N epsilon of Lysine) undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined prerequisite-ptm prerequisite-ptm prerequisite ptm required ptm prerequisite-ptm required-ptm ecolx Escherichia coli direct interaction direct interaction irf3-tbk1-5 1 12 enzyme target enzyme target substrate substrate unspecified role unspecified role pS97/788/251/398/427 pS97/788/251/398/427 opser O-phospho-L-serine (2S)-2-amino-3-(phosphonooxy)propanoic acid 2-amino-3-hydroxypropanoic acid 3-phosphate 2-azanyl-3-(phosphonooxy)propanoic acid ACT_SITE Phosphoserine intermediate MOD_RES Phosphoserine O-phospho-L-serine O-phosphonoserine O-phosphorylated L-serine O3-phosphoserine serine phosphate ester OPSer Phospho Phospho Seryl Phosphorylation phosphorylations modified residue ms mass detection of residue modification modified residue ms certain certain sequence position certain certain certain sequence position certain certain certain sequence position certain certain certain sequence position certain certain certain sequence position certain certain certain sequence position certain certain certain sequence position certain certain certain sequence position certain certain certain sequence position certain certain certain sequence position certain resulting-ptm resulting-ptm resulting ptm resulting-ptm pT3/75/180/237/244/404 pT3/75/180/237/244/404 opthr O-phospho-L-threonine (2S,3R)-2-amino-3-(phosphonooxy)butanoic acid 2-amino-3-hydroxybutanoic acid 3-phosphate 2-azanyl-3-(phosphonooxy)butanoic acid MOD_RES Phosphothreonine O-phospho-L-threonine O-phosphorylated L-threonine O3-phosphothreonine threonine phosphate ester OPThr Phospho Phospho Threonyl Phosphorylation phosphorylationt modified residue ms mass detection of residue modification modified residue ms certain certain sequence position certain certain certain sequence position certain certain certain sequence position certain certain certain sequence position certain certain certain sequence position certain certain certain sequence position certain certain certain sequence position certain certain certain sequence position certain certain certain sequence position certain certain certain sequence position certain certain certain sequence position certain certain certain sequence position certain resulting-ptm resulting-ptm resulting ptm resulting-ptm ecolx Escherichia coli 11 enzyme enzyme unspecified role unspecified role spofr Spodoptera frugiperda (Fall armyworm) Fall armyworm phosphorylation phosphorylation reaction phosphorylation tbk1-3 3 11 putative self putative self unspecified role unspecified role Region 1-657 Region 1-657 sufficient to bind sufficient binding region sufficient to bind deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain Q9WUN2:p.Lys38Ala K38A mutation disrupting rate mutation disrupting interaction rate mutation disrupting rate alanine scanning alanine scanning certain certain sequence position certain certain certain sequence position certain K A This feature has been corrected as a result of our quality control procedures. The original label was 'K38A'. Wed May 02 16:09:17 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'lys38ala' Tue Jun 30 18:02:44 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Lys38Ala' Q9WUN2:p.Ser172Ala S172A mutation disrupting rate mutation disrupting interaction rate mutation disrupting rate alanine scanning alanine scanning certain certain sequence position certain certain certain sequence position certain S A This feature has been corrected as a result of our quality control procedures. The original label was 'S172A'. Wed May 02 19:20:12 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'ser172ala' Tue Jun 30 18:11:04 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Ser172Ala' spofr Spodoptera frugiperda (Fall armyworm) Fall armyworm phosphorylation phosphorylation reaction phosphorylation true