DIP Database of Interacting Proteins 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ dip@mbi.ucla.edu Mature HIV-1 capsid structure by cryo-electron microscopy and all-atom molecular dynamics. Mature HIV-1 capsid structure by cryo-electron microscopy and all-atom molecular dynamics. Nature 2013 imex curation Zhao G., Perilla JR., Yufenyuy EL., Meng X., Chen B., Ning J., Ahn J., Gronenborn AM., Schulten K., Aiken C., Zhang P. Only protein-protein interactions human Homo sapiens Human crosslink cross-linking study crosslink western blot western blot Immuno blot Immuno blot Zhao G., Perilla JR., Yufenyuy EL., Meng X., Chen B., Ning J., Ahn J., Gronenborn AM., Schulten K., Aiken C., Zhang P. DIP original experiment: DIP-252914X Nature 2013 IMEx Mature HIV-1 capsid structure by cryo-electron microscopy and all-atom molecular dynamics. Mature HIV-1 capsid structure by cryo-electron microscopy and all-atom molecular dynamics. Mature HIV-1 capsid structure by cryo-electron microscopy and all-atom molecular dynamics. Nature 2013 imex curation Zhao G., Perilla JR., Yufenyuy EL., Meng X., Chen B., Ning J., Ahn J., Gronenborn AM., Schulten K., Aiken C., Zhang P. Only protein-protein interactions ecolx Escherichia coli 3d-em 3D electron microscopy 3D-EM electron tomog predetermined predetermined participant predetermined Zhao G., Perilla JR., Yufenyuy EL., Meng X., Chen B., Ning J., Ahn J., Gronenborn AM., Schulten K., Aiken C., Zhang P. DIP original experiment: DIP-252913X Nature 2013 IMEx Mature HIV-1 capsid structure by cryo-electron microscopy and all-atom molecular dynamics. q79791_9hiv1 Gag polyprotein gag protein protein 9hiv1 Human immunodeficiency virus 1 MGARASVLSGGELDKWEKIRLRPGGKKQYRLKHIVWASRELERFAVNPGLLETSEGCRQILRQLQPSLQTGSEERRSLFNTVAVLYCVHQRIDVKDTKEALDKIEEEQNKSKKKAQQAAADTGNSSQVSQNYPIVQNLQGQMVHQAISPRTLNAWVKVVEEKAFSPEVIPMFSALSEGATPQDLNTMLNTVGGHQAAMQMLKETINEEAAEWDRLHPVHAGPIAPGQMREPRGSDIAGTTSTLQEQIGWMTHNPPIPVGEIYKRWIILGLNKIVRMYSPTSILDIRQGPKEPFRDYVDRFYKTLRAEQASQEVKNWMTETLLVQNANPDCKTILKALGPAATLEEMMTACQGVGGPGHKARVLAEAMSQVTNPATIMIQRGNFRNQKKTVKCFNCGKEGHIAKNCRAPRKKGCWKCGKEGHQMKDCTERQANFLGKIWPSHKGRPGNFLQSRPEPTAPPEESFRFGEETTTPSQKQEPIDKELYPLASLRSLFGSDPSSQ DIP protein Q79791 original sequence version: 88 gag-17 2 3 unspecified role unspecified role unspecified role unspecified role Capsid subunit Region 133-363 polyprotein frag polyprotein fragment polyprotein frag certain certain sequence position certain certain certain sequence position certain ecolx Escherichia coli direct interaction direct interaction gag-4 1 3 unspecified role unspecified role unspecified role unspecified role Capsid subunit Region 133-363 polyprotein frag polyprotein fragment polyprotein frag certain certain sequence position certain certain certain sequence position certain Q79791:p.Ala336Cys A336C mutation mutation certain certain sequence position certain certain certain sequence position certain A C This feature has been corrected as a result of our quality control procedures. The original label was 'A336C'. Wed May 02 16:54:09 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'ala336cys' Tue Jun 30 17:08:15 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Ala336Cys' human Homo sapiens Human physical association physical association