IntAct European Bioinformatics Institute IntAct intact http://www.ebi.ac.uk/ http://www.ebi.ac.uk/intact/query/${ac} EBI-[0-9]+|IA:[0-9]+ INTerAction database (IntAct) provides an open source database and toolkit for the storage, presentation and analysis of molecular interactions. http://www.ebi.ac.uk/intact European Bioinformatics Institute; Wellcome Trust Genome Campus; Hinxton, Cambridge; CB10 1SD; United Kingdom http://www.ebi.ac.uk/intact/ Molecular basis of antiangiogenic thrombospondin-1 type 1 repeat domain interactions with CD36. Molecular basis of antiangiogenic thrombospondin-1 type 1 repeat domain interactions with CD36. Arteriosclerosis, thrombosis, and vascular biology 2013 imex curation Klenotic PA., Page RC., Li W., Amick J., Misra S., Silverstein RL. DSP=72? rsilverstein@mcw.edu,misras@ccf.org Only protein-protein interactions in vitro In vitro elisa enzyme linked immunosorbent assay ELISA ELISA elisa antibody detection identification by antibody antibody detection Klenotic PA., Page RC., Li W., Amick J., Misra S., Silverstein RL. DSP=72? The TSP1 TRS2 domain is given as aas 429-469 in Supp fig 5, but the Supplementary methods states that there is a stop codon between residues P472 and I473 . rsilverstein@mcw.edu,misras@ccf.org Accepted 2017-FEB-28 AT 15:33 GMT AT 15:33 GMT by ORCHARD Arteriosclerosis, thrombosis, and vascular biology 2013 imex curation Molecular basis of antiangiogenic thrombospondin-1 type 1 repeat domain interactions with CD36. Molecular basis of antiangiogenic thrombospondin-1 type 1 repeat domain interactions with CD36. Arteriosclerosis, thrombosis, and vascular biology 2013 imex curation Klenotic PA., Page RC., Li W., Amick J., Misra S., Silverstein RL. DSP=72? rsilverstein@mcw.edu,misras@ccf.org Only protein-protein interactions in vitro In vitro nmr nuclear magnetic resonance NMR NMR nmr predetermined predetermined participant predetermined Klenotic PA., Page RC., Li W., Amick J., Misra S., Silverstein RL. DSP=72? rsilverstein@mcw.edu,misras@ccf.org Accepted 2017-FEB-28 AT 15:33 GMT AT 15:33 GMT by ORCHARD Arteriosclerosis, thrombosis, and vascular biology 2013 imex curation cd36_human Platelet glycoprotein 4 GP3B GP4 Platelet glycoprotein IV Glycoprotein IIIb Leukocyte differentiation antigen CD36 PAS IV PAS-4 Platelet collagen receptor Fatty acid translocase Thrombospondin receptor CD36 protein protein human Homo sapiens Human MGCDRNCGLIAGAVIGAVLAVFGGILMPVGDLLIQKTIKKQVVLEEGTIAFKNWVKTGTEVYRQFWIFDVQNPQEVMMNSSNIQVKQRGPYTYRVRFLAKENVTQDAEDNTVSFLQPNGAIFEPSLSVGTEADNFTVLNLAVAAASHIYQNQFVQMILNSLINKSKSSMFQVRTLRELLWGYRDPFLSLVPYPVTTTVGLFYPYNNTADGVYKVFNGKDNISKVAIIDTYKGKRNLSYWESHCDMINGTDAASFPPFVEKSQVLQFFSSDICRSIYAVFESDVNLKGIPVYRFVLPSKAFASPVENPDNYCFCTEKIISKNCTSYGVLDISKCKEGRPVYISLPHFLYASPDVSEPIDGLNPNEEEHRTYLDIEPITGFTLQFAKRLQVNLLVKPSEKIQVLKNLKRNYIVPILWLNETGTIGDEKANMFRSQVTGKINLLGLIEMILLSVGVVMFVAFMISYCACRSKTIK 543E748259A094FA p07996-pro_0000035842 Thrombospondin-1 THBS1 TSP TSP1 Glycoprotein G protein protein human Homo sapiens Human NRIPESGGDNSVFDIFELTGAARKGSGRRLVKGPDPSSPAFRIEDANLIPPVPDDKFQDLVDAVRAEKGFLLLASLRQMKKTRGTLLALERKDHSGQVFSVVSNGKAGTLDLSLTVQGKQHVVSVEEALLATGQWKSITLFVQEDRAQLYIDCEKMENAELDVPIQSVFTRDLASIARLRIAKGGVNDNFQGVLQNVRFVFGTTPEDILRNKGCSSSTSVLLTLDNNVVNGSSPAIRTNYIGHKTKDLQAICGISCDELSSMVLELRGLRTIVTTLQDSIRKVTEENKELANELRRPPLCYHNGVQYRNNEEWTVDSCTECHCQNSVTICKKVSCPIMPCSNATVPDGECCPRCWPSDSADDGWSPWSEWTSCSTSCGNGIQQRGRSCDSLNNRCEGSSVQTRTCHIQECDKRFKQDGGWSHWSPWSSCSVTCGDGVITRIRLCNSPSPQMNGKPCEGEARETKACKKDACPINGGWGPWSPWDICSVTCGGGVQKRSRLCNNPTPQFGGKDCVGDVTENQICNKQDCPIDGCLSNPCFAGVKCTSYPDGSWKCGACPPGYSGNGIQCTDVDECKEVPDACFNHNGEHRCENTDPGYNCLPCPPRFTGSQPFGQGVEHATANKQVCKPRNPCTDGTHDCNKNAKCNYLGHYSDPMYRCECKPGYAGNGIICGEDTDLDGWPNENLVCVANATYHCKKDNCPNLPNSGQEDYDKDGIGDACDDDDDNDKIPDDRDNCPFHYNPAQYDYDRDDVGDRCDNCPYNHNPDQADTDNNGEGDACAADIDGDGILNERDNCQYVYNVDQRDTDMDGVGDQCDNCPLEHNPDQLDSDSDRIGDTCDNNQDIDEDGHQNNLDNCPYVPNANQADHDKDGKGDACDHDDDNDGIPDDKDNCRLVPNPDQKDSDGDGRGDACKDDFDHDSVPDIDDICPENVDISETDFRRFQMIPLDPKGTSQNDPNWVVRHQGKELVQTVNCDPGLAVGYDEFNAVDFSGTFFINTERDDDYAGFVFGYQSSSRFYVVMWKQVTQSYWDTNPTRAQGYSGLSVKVVNSTTGPGEHLRNALWHTGNTPGQVRTLWHDPRHIGWKDFTAYRWRLSHRPKTGFIRVVMYEGKKIMADSGPIYDKTYAGGRLGLFVFSQEMVFFSDLKYECRDP 19 1170 3F55044733F5960A thbs1-cd36-1 1 3 unspecified role unspecified role prey prey clesh_domain sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain ubiquitin_tag tag tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined ecoli Escherichia coli (strain K12) 4 unspecified role unspecified role bait bait region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined tsr2_domain sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain range range ecoli Escherichia coli (strain K12) 7 12 direct interaction direct interaction 2B thbs1-cd36-2 2 3 unspecified role unspecified role neutral component neutral component clesh_domain sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain ubiquitin_tag tag tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined ecoli Escherichia coli (strain K12) 4 unspecified role unspecified role neutral component neutral component region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined tsr2_domain sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain range range region 15n label 15n label 15N N15 15N N15 undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined ecoli Escherichia coli (strain K12) 15 20 direct interaction direct interaction 4A