DIP Database of Interacting Proteins 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ dip@mbi.ucla.edu PICK1 and ICA69 control insulin granule trafficking and their deficiencies lead to impaired glucose tolerance. PICK1 and ICA69 control insulin granule trafficking and their deficiencies lead to impaired glucose tolerance. PLoS biology 2012 imex curation Cao M., Mao Z., Kam C., Xiao N., Cao X., Shen C., Cheng KK., Xu A., Lee KM., Jiang L., Xia J. Only protein-protein interactions mouse Mus musculus Mouse anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Cao M., Mao Z., Kam C., Xiao N., Cao X., Shen C., Cheng KK., Xu A., Lee KM., Jiang L., Xia J. DIP original experiment: DIP-252433X PLoS biology 2012 IMEx PICK1 and ICA69 control insulin granule trafficking and their deficiencies lead to impaired glucose tolerance. PICK1 and ICA69 control insulin granule trafficking and their deficiencies lead to impaired glucose tolerance. PICK1 and ICA69 control insulin granule trafficking and their deficiencies lead to impaired glucose tolerance. PLoS biology 2012 imex curation Cao M., Mao Z., Kam C., Xiao N., Cao X., Shen C., Cheng KK., Xu A., Lee KM., Jiang L., Xia J. Only protein-protein interactions mouse Mus musculus Mouse anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Cao M., Mao Z., Kam C., Xiao N., Cao X., Shen C., Cheng KK., Xu A., Lee KM., Jiang L., Xia J. DIP original experiment: DIP-252434X PLoS biology 2012 IMEx PICK1 and ICA69 control insulin granule trafficking and their deficiencies lead to impaired glucose tolerance. ica69_mouse Islet cell autoantigen 1 Ica1 Icap69 69 kDa islet cell autoantigen Islet cell autoantigen p69 protein protein mouse Mus musculus Mouse MSGHKCYSWELQDRFAQDKSVVNKMQQKYWETKQAFIKATGKKEDEHVVASDADLDAKLELFHSIQRTCLDLSKAIVLYQKRICFLSQEENELGKFLRSQGFQDKTRAGKMMQATGKALCFSSQQRLALRNPLCRFHQEVETFRHRAISDTWLTVNRMEQYRTEYRGALLWMKDVSQELDPDLYKQMEKFRKVQTQVRLAKKNFDKLKMDVCQKVDLLGASRCNLLSHMLATYQTTLLHFWEKTSHTMAAIHESFKGYQPYEFTTLKSLQDPMKKLVEKEGKKTSWRENREAVAPEPRQLISLEDEHKDSSAYKTEEGTSVLSSVDKGSVHDTCSGPIDELLDGKPEEACLGPTAGTPEPESGDKDDLLLLNEIFSTSCLDEGEFSREWAAVFGDDQLKEPAPMGAQGEPDPKPQIGSGFLPSQLLDQNMKDLQASLQEPAKAASDLTAWFSLFADLDPLSNPDAVGKTDKEHELLNA DIP protein P97411 original sequence version: 91 pick1_mouse PRKCA-binding protein Pick1 Prkcabp Protein kinase C-alpha-binding protein Protein interacting with C kinase 1 protein protein mouse Mus musculus Mouse MFADLDYDIEEDKLGIPTVPGKVTLQKDAQNLIGISIGGGAQYCPCLYIVQVFDNTPAALDGTVAAGDEITGVNGKSIKGKTKVEVAKMIQEVKGEVTIHYNKLQADPKQGMSLDIVLKKVKHRLVENMSSGTADALGLSRAILCNDGLVKRLEELERTAELYKGMTEHTKNLLRAFYELSQTHRAFGDVFSVIGVREPQPAASEAFVKFADAHRSIEKFGIRLLKTIKPMLTDLNTYLNKAIPDTRLTIKKYLDVKFEYLSYCLKVKEMDDEEYSCIGPRRALYRVSTGNYEYRLILRCRQEARARFSQMRKDVLEKMELLDQKHVQDIVFQLQRFVSTMSKYYNDCYAVLQDADVFPIEVDLAHTTLAYGPNQGSFTDGEEEDEEEEDGAAREVSKDACGATGPTDKGGSWCDS DIP protein Q62083 original sequence version: 125 DIP protein Q62083 original sequence version: 118 437369D0AB7DCE7B pick1-ica1-1 1 3 unspecified role unspecified role prey prey mouse Mus musculus Mouse 4 unspecified role unspecified role bait bait mouse Mus musculus Mouse physical association physical association ica1-pick1-1 2 3 unspecified role unspecified role bait bait mouse Mus musculus Mouse 4 unspecified role unspecified role prey prey mouse Mus musculus Mouse physical association physical association