DIP Database of Interacting Proteins 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ dip@mbi.ucla.edu ER-stress-induced transcriptional regulation increases protein synthesis leading to cell death. ER-stress-induced transcriptional regulation increases protein synthesis leading to cell death. Nature cell biology 2013 imex curation Han J., Back SH., Hur J., Lin YH., Gildersleeve R., Shan J., Yuan CL., Krokowski D., Wang S., Hatzoglou M., Kilberg MS., Sartor MA., Kaufman RJ. Only protein-protein interactions mouse Mus musculus Mouse anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Han J., Back SH., Hur J., Lin YH., Gildersleeve R., Shan J., Yuan CL., Krokowski D., Wang S., Hatzoglou M., Kilberg MS., Sartor MA., Kaufman RJ. DIP original experiment: DIP-259921X Nature cell biology 2013 IMEx ER-stress-induced transcriptional regulation increases protein synthesis leading to cell death. ER-stress-induced transcriptional regulation increases protein synthesis leading to cell death. ER-stress-induced transcriptional regulation increases protein synthesis leading to cell death. Nature cell biology 2013 imex curation Han J., Back SH., Hur J., Lin YH., Gildersleeve R., Shan J., Yuan CL., Krokowski D., Wang S., Hatzoglou M., Kilberg MS., Sartor MA., Kaufman RJ. Only protein-protein interactions human Homo sapiens Human anti tag coip anti tag coimmunoprecipitation anti tag coip anti tag western anti tag western blot anti tag western Han J., Back SH., Hur J., Lin YH., Gildersleeve R., Shan J., Yuan CL., Krokowski D., Wang S., Hatzoglou M., Kilberg MS., Sartor MA., Kaufman RJ. DIP original experiment: DIP-259923X Nature cell biology 2013 IMEx ER-stress-induced transcriptional regulation increases protein synthesis leading to cell death. ER-stress-induced transcriptional regulation increases protein synthesis leading to cell death. ER-stress-induced transcriptional regulation increases protein synthesis leading to cell death. Nature cell biology 2013 imex curation Han J., Back SH., Hur J., Lin YH., Gildersleeve R., Shan J., Yuan CL., Krokowski D., Wang S., Hatzoglou M., Kilberg MS., Sartor MA., Kaufman RJ. Only protein-protein interactions human Homo sapiens Human anti bait coip anti bait coimmunoprecipitation anti bait coip anti tag western anti tag western blot anti tag western Han J., Back SH., Hur J., Lin YH., Gildersleeve R., Shan J., Yuan CL., Krokowski D., Wang S., Hatzoglou M., Kilberg MS., Sartor MA., Kaufman RJ. DIP original experiment: DIP-259922X Nature cell biology 2013 IMEx ER-stress-induced transcriptional regulation increases protein synthesis leading to cell death. ddit3_mouse DNA damage-inducible transcript 3 protein Ddit3 Chop Chop10 Gadd153 C/EBP zeta C/EBP-homologous protein C/EBP-homologous protein 10 CCAAT/enhancer-binding protein homologous protein Growth arrest and DNA-damage-inducible protein GADD153 protein protein mouse Mus musculus Mouse MAAESLPFTLETVSSWELEAWYEDLQEVLSSDEIGGTYISSPGNEEEESKTFTTLDPASLAWLTEEPGPTEVTRTSQSPRSPDSSQSSMAQEEEEEEQGRTRKRKQSGQCPARPGKQRMKEKEQENERKVAQLAEENERLKQEIERLTREVETTRRALIDRMVSLHQA DIP protein P35639 original sequence version: 112 CA423B79512F33AB atf4_mouse Cyclic AMP-dependent transcription factor ATF-4 Atf4 C/EBP-related ATF Activating transcription factor 4 Creb2 Cyclic AMP-responsive element-binding protein 2 protein protein mouse Mus musculus Mouse MTEMSFLNSEVLAGDLMSPFDQSGLGAEESLGLLDDYLEVAKHLKPHGFSSDKAGSSEWPAMDDGLASASDTGKEDAFSGTDWMLEKMDLKEFDFDALFRMDDLETMPDELLTTLDDTCDLFAPLVQETNKEPPQTVNPIGHLPESLIKVDQVAPFTFLQPFPCSPGVLSSTPEHSFSLELGSEVDISEGDRKPDSAAYITLIPPCVKEEDTPSDNDSGICMSPESYLGSPQHSPSTSRAPPDNLPSPGGSRGSPRPKPYDPPGVSLTAKVKTEKLDKKLKKMEQNKTAATRYRQKKRAEQEALTGECKELEKKNEALKEKADSLAKEIQYLKDLIEEVRKARGKKRVP DIP protein Q06507 original sequence version: 77 DIP protein Q06507 original sequence version: 105 0C3F895755B1C7B9 atf4-ddit3-2 1 4 unspecified role unspecified role prey prey mouse Mus musculus Mouse 5 unspecified role unspecified role bait bait mouse Mus musculus Mouse physical association physical association atf4-ddit3-3 3 4 unspecified role unspecified role prey prey Flag-tag Flag-tag flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged n-term range n-terminal range n-term range n-term range n-terminal range n-term range human Homo sapiens Human 5 unspecified role unspecified role bait bait human Homo sapiens Human physical association physical association ddit3-atf4-4 2 4 unspecified role unspecified role bait bait Flag-tag Flag-tag flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged n-term range n-terminal range n-term range n-term range n-terminal range n-term range human Homo sapiens Human 5 unspecified role unspecified role prey prey human Homo sapiens Human physical association physical association