DIP Database of Interacting Proteins 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ dip@mbi.ucla.edu Architecture of human translation initiation factor 3. Architecture of human translation initiation factor 3. Structure (London, England : 1993) 2013 imex curation Querol-Audi J., Sun C., Vogan JM., Smith MD., Gu Y., Cate JH., Nogales E. Only protein-protein interactions ecolx Escherichia coli tem transmission electron microscopy tem predetermined predetermined participant predetermined Querol-Audi J., Sun C., Vogan JM., Smith MD., Gu Y., Cate JH., Nogales E. DIP original experiment: DIP-252284X Structure (London, England : 1993) 2013 IMEx Architecture of human translation initiation factor 3. Architecture of human translation initiation factor 3. Architecture of human translation initiation factor 3. Structure (London, England : 1993) 2013 imex curation Querol-Audi J., Sun C., Vogan JM., Smith MD., Gu Y., Cate JH., Nogales E. Only protein-protein interactions ecolx Escherichia coli pull down pull down weight by comassie molecular weight estimation by coomasie staining weight by comassie Querol-Audi J., Sun C., Vogan JM., Smith MD., Gu Y., Cate JH., Nogales E. DIP original experiment: DIP-252307X Structure (London, England : 1993) 2013 IMEx Architecture of human translation initiation factor 3. Architecture of human translation initiation factor 3. Architecture of human translation initiation factor 3. Structure (London, England : 1993) 2013 imex curation Querol-Audi J., Sun C., Vogan JM., Smith MD., Gu Y., Cate JH., Nogales E. Only protein-protein interactions in vitro In vitro pull down pull down weight by comassie molecular weight estimation by coomasie staining weight by comassie Querol-Audi J., Sun C., Vogan JM., Smith MD., Gu Y., Cate JH., Nogales E. DIP original experiment: DIP-252296X Structure (London, England : 1993) 2013 IMEx Architecture of human translation initiation factor 3. Architecture of human translation initiation factor 3. Architecture of human translation initiation factor 3. Structure (London, England : 1993) 2013 imex curation Querol-Audi J., Sun C., Vogan JM., Smith MD., Gu Y., Cate JH., Nogales E. Only protein-protein interactions ecolx Escherichia coli pull down pull down weight by comassie molecular weight estimation by coomasie staining weight by comassie Querol-Audi J., Sun C., Vogan JM., Smith MD., Gu Y., Cate JH., Nogales E. DIP original experiment: DIP-252308X Structure (London, England : 1993) 2013 IMEx Architecture of human translation initiation factor 3. Architecture of human translation initiation factor 3. Architecture of human translation initiation factor 3. Structure (London, England : 1993) 2013 imex curation Querol-Audi J., Sun C., Vogan JM., Smith MD., Gu Y., Cate JH., Nogales E. Only protein-protein interactions ecolx Escherichia coli pull down pull down weight by comassie molecular weight estimation by coomasie staining weight by comassie Querol-Audi J., Sun C., Vogan JM., Smith MD., Gu Y., Cate JH., Nogales E. DIP original experiment: DIP-252305X Structure (London, England : 1993) 2013 IMEx Architecture of human translation initiation factor 3. Architecture of human translation initiation factor 3. Architecture of human translation initiation factor 3. Structure (London, England : 1993) 2013 imex curation Querol-Audi J., Sun C., Vogan JM., Smith MD., Gu Y., Cate JH., Nogales E. Only protein-protein interactions in vitro In vitro 3d-em 3D electron microscopy 3D-EM electron tomog predetermined predetermined participant predetermined Querol-Audi J., Sun C., Vogan JM., Smith MD., Gu Y., Cate JH., Nogales E. DIP original experiment: DIP-252289X Structure (London, England : 1993) 2013 IMEx Architecture of human translation initiation factor 3. Architecture of human translation initiation factor 3. Architecture of human translation initiation factor 3. Structure (London, England : 1993) 2013 imex curation Querol-Audi J., Sun C., Vogan JM., Smith MD., Gu Y., Cate JH., Nogales E. Only protein-protein interactions in vitro In vitro pull down pull down weight by comassie molecular weight estimation by coomasie staining weight by comassie Querol-Audi J., Sun C., Vogan JM., Smith MD., Gu Y., Cate JH., Nogales E. DIP original experiment: DIP-252297X Structure (London, England : 1993) 2013 IMEx Architecture of human translation initiation factor 3. Architecture of human translation initiation factor 3. Architecture of human translation initiation factor 3. Structure (London, England : 1993) 2013 imex curation Querol-Audi J., Sun C., Vogan JM., Smith MD., Gu Y., Cate JH., Nogales E. Only protein-protein interactions in vitro In vitro tem transmission electron microscopy tem predetermined predetermined participant predetermined Querol-Audi J., Sun C., Vogan JM., Smith MD., Gu Y., Cate JH., Nogales E. DIP original experiment: DIP-252288X Structure (London, England : 1993) 2013 IMEx Architecture of human translation initiation factor 3. Architecture of human translation initiation factor 3. Architecture of human translation initiation factor 3. Structure (London, England : 1993) 2013 imex curation Querol-Audi J., Sun C., Vogan JM., Smith MD., Gu Y., Cate JH., Nogales E. Only protein-protein interactions ecolx Escherichia coli pull down pull down weight by comassie molecular weight estimation by coomasie staining weight by comassie Querol-Audi J., Sun C., Vogan JM., Smith MD., Gu Y., Cate JH., Nogales E. DIP original experiment: DIP-252304X Structure (London, England : 1993) 2013 IMEx Architecture of human translation initiation factor 3. Architecture of human translation initiation factor 3. Architecture of human translation initiation factor 3. Structure (London, England : 1993) 2013 imex curation Querol-Audi J., Sun C., Vogan JM., Smith MD., Gu Y., Cate JH., Nogales E. Only protein-protein interactions in vitro In vitro molecular sieving molecular sieving Gel Filtration Size Exclusion Chromatography Size Exclusion Chromatography Gel Filtration Sizing column weight by comassie molecular weight estimation by coomasie staining weight by comassie Querol-Audi J., Sun C., Vogan JM., Smith MD., Gu Y., Cate JH., Nogales E. DIP original experiment: DIP-252298X Structure (London, England : 1993) 2013 IMEx Architecture of human translation initiation factor 3. Architecture of human translation initiation factor 3. Architecture of human translation initiation factor 3. Structure (London, England : 1993) 2013 imex curation Querol-Audi J., Sun C., Vogan JM., Smith MD., Gu Y., Cate JH., Nogales E. Only protein-protein interactions ecolx Escherichia coli ion exchange chrom ion exchange chromatography IEC IEC ion exchange chrom weight by comassie molecular weight estimation by coomasie staining weight by comassie Querol-Audi J., Sun C., Vogan JM., Smith MD., Gu Y., Cate JH., Nogales E. DIP original experiment: DIP-252301X Structure (London, England : 1993) 2013 IMEx Architecture of human translation initiation factor 3. Architecture of human translation initiation factor 3. Architecture of human translation initiation factor 3. Structure (London, England : 1993) 2013 imex curation Querol-Audi J., Sun C., Vogan JM., Smith MD., Gu Y., Cate JH., Nogales E. Only protein-protein interactions in vitro In vitro pull down pull down weight by comassie molecular weight estimation by coomasie staining weight by comassie Querol-Audi J., Sun C., Vogan JM., Smith MD., Gu Y., Cate JH., Nogales E. DIP original experiment: DIP-252291X Structure (London, England : 1993) 2013 IMEx Architecture of human translation initiation factor 3. Architecture of human translation initiation factor 3. Architecture of human translation initiation factor 3. Structure (London, England : 1993) 2013 imex curation Querol-Audi J., Sun C., Vogan JM., Smith MD., Gu Y., Cate JH., Nogales E. Only protein-protein interactions in vitro In vitro molecular sieving molecular sieving Gel Filtration Size Exclusion Chromatography Size Exclusion Chromatography Gel Filtration Sizing column weight by comassie molecular weight estimation by coomasie staining weight by comassie Querol-Audi J., Sun C., Vogan JM., Smith MD., Gu Y., Cate JH., Nogales E. DIP original experiment: DIP-252300X Structure (London, England : 1993) 2013 IMEx Architecture of human translation initiation factor 3. Architecture of human translation initiation factor 3. Architecture of human translation initiation factor 3. Structure (London, England : 1993) 2013 imex curation Querol-Audi J., Sun C., Vogan JM., Smith MD., Gu Y., Cate JH., Nogales E. Only protein-protein interactions in vitro In vitro pull down pull down weight by comassie molecular weight estimation by coomasie staining weight by comassie Querol-Audi J., Sun C., Vogan JM., Smith MD., Gu Y., Cate JH., Nogales E. DIP original experiment: DIP-252294X Structure (London, England : 1993) 2013 IMEx Architecture of human translation initiation factor 3. Architecture of human translation initiation factor 3. Architecture of human translation initiation factor 3. Structure (London, England : 1993) 2013 imex curation Querol-Audi J., Sun C., Vogan JM., Smith MD., Gu Y., Cate JH., Nogales E. Only protein-protein interactions ecolx Escherichia coli molecular sieving molecular sieving Gel Filtration Size Exclusion Chromatography Size Exclusion Chromatography Gel Filtration Sizing column predetermined predetermined participant predetermined Querol-Audi J., Sun C., Vogan JM., Smith MD., Gu Y., Cate JH., Nogales E. DIP original experiment: DIP-252290X Structure (London, England : 1993) 2013 IMEx Architecture of human translation initiation factor 3. Architecture of human translation initiation factor 3. Architecture of human translation initiation factor 3. Structure (London, England : 1993) 2013 imex curation Querol-Audi J., Sun C., Vogan JM., Smith MD., Gu Y., Cate JH., Nogales E. Only protein-protein interactions in vitro In vitro tem transmission electron microscopy tem predetermined predetermined participant predetermined Querol-Audi J., Sun C., Vogan JM., Smith MD., Gu Y., Cate JH., Nogales E. DIP original experiment: DIP-252286X Structure (London, England : 1993) 2013 IMEx Architecture of human translation initiation factor 3. Architecture of human translation initiation factor 3. Architecture of human translation initiation factor 3. Structure (London, England : 1993) 2013 imex curation Querol-Audi J., Sun C., Vogan JM., Smith MD., Gu Y., Cate JH., Nogales E. Only protein-protein interactions ecolx Escherichia coli 3d-em 3D electron microscopy 3D-EM electron tomog predetermined predetermined participant predetermined Querol-Audi J., Sun C., Vogan JM., Smith MD., Gu Y., Cate JH., Nogales E. DIP original experiment: DIP-252285X Structure (London, England : 1993) 2013 IMEx Architecture of human translation initiation factor 3. Architecture of human translation initiation factor 3. Architecture of human translation initiation factor 3. Structure (London, England : 1993) 2013 imex curation Querol-Audi J., Sun C., Vogan JM., Smith MD., Gu Y., Cate JH., Nogales E. Only protein-protein interactions in vitro In vitro 3d-em 3D electron microscopy 3D-EM electron tomog predetermined predetermined participant predetermined Querol-Audi J., Sun C., Vogan JM., Smith MD., Gu Y., Cate JH., Nogales E. DIP original experiment: DIP-252287X Structure (London, England : 1993) 2013 IMEx Architecture of human translation initiation factor 3. Architecture of human translation initiation factor 3. Architecture of human translation initiation factor 3. Structure (London, England : 1993) 2013 imex curation Querol-Audi J., Sun C., Vogan JM., Smith MD., Gu Y., Cate JH., Nogales E. Only protein-protein interactions in vitro In vitro pull down pull down weight by comassie molecular weight estimation by coomasie staining weight by comassie Querol-Audi J., Sun C., Vogan JM., Smith MD., Gu Y., Cate JH., Nogales E. DIP original experiment: DIP-252293X Structure (London, England : 1993) 2013 IMEx Architecture of human translation initiation factor 3. Architecture of human translation initiation factor 3. Architecture of human translation initiation factor 3. Structure (London, England : 1993) 2013 imex curation Querol-Audi J., Sun C., Vogan JM., Smith MD., Gu Y., Cate JH., Nogales E. Only protein-protein interactions in vitro In vitro pull down pull down weight by comassie molecular weight estimation by coomasie staining weight by comassie Querol-Audi J., Sun C., Vogan JM., Smith MD., Gu Y., Cate JH., Nogales E. DIP original experiment: DIP-252292X Structure (London, England : 1993) 2013 IMEx Architecture of human translation initiation factor 3. Architecture of human translation initiation factor 3. Architecture of human translation initiation factor 3. Structure (London, England : 1993) 2013 imex curation Querol-Audi J., Sun C., Vogan JM., Smith MD., Gu Y., Cate JH., Nogales E. Only protein-protein interactions in vitro In vitro pull down pull down weight by comassie molecular weight estimation by coomasie staining weight by comassie Querol-Audi J., Sun C., Vogan JM., Smith MD., Gu Y., Cate JH., Nogales E. DIP original experiment: DIP-252295X Structure (London, England : 1993) 2013 IMEx Architecture of human translation initiation factor 3. Architecture of human translation initiation factor 3. Architecture of human translation initiation factor 3. Structure (London, England : 1993) 2013 imex curation Querol-Audi J., Sun C., Vogan JM., Smith MD., Gu Y., Cate JH., Nogales E. Only protein-protein interactions in vitro In vitro pull down pull down weight by comassie molecular weight estimation by coomasie staining weight by comassie Querol-Audi J., Sun C., Vogan JM., Smith MD., Gu Y., Cate JH., Nogales E. DIP original experiment: DIP-252299X Structure (London, England : 1993) 2013 IMEx Architecture of human translation initiation factor 3. Architecture of human translation initiation factor 3. Architecture of human translation initiation factor 3. Structure (London, England : 1993) 2013 imex curation Querol-Audi J., Sun C., Vogan JM., Smith MD., Gu Y., Cate JH., Nogales E. Only protein-protein interactions ecolx Escherichia coli pull down pull down weight by comassie molecular weight estimation by coomasie staining weight by comassie Querol-Audi J., Sun C., Vogan JM., Smith MD., Gu Y., Cate JH., Nogales E. DIP original experiment: DIP-252306X Structure (London, England : 1993) 2013 IMEx Architecture of human translation initiation factor 3. Architecture of human translation initiation factor 3. Architecture of human translation initiation factor 3. Structure (London, England : 1993) 2013 imex curation Querol-Audi J., Sun C., Vogan JM., Smith MD., Gu Y., Cate JH., Nogales E. Only protein-protein interactions ecolx Escherichia coli pull down pull down weight by comassie molecular weight estimation by coomasie staining weight by comassie Querol-Audi J., Sun C., Vogan JM., Smith MD., Gu Y., Cate JH., Nogales E. DIP original experiment: DIP-252309X Structure (London, England : 1993) 2013 IMEx Architecture of human translation initiation factor 3. Architecture of human translation initiation factor 3. Architecture of human translation initiation factor 3. Structure (London, England : 1993) 2013 imex curation Querol-Audi J., Sun C., Vogan JM., Smith MD., Gu Y., Cate JH., Nogales E. Only protein-protein interactions ecolx Escherichia coli molecular sieving molecular sieving Gel Filtration Size Exclusion Chromatography Size Exclusion Chromatography Gel Filtration Sizing column weight by comassie molecular weight estimation by coomasie staining weight by comassie Querol-Audi J., Sun C., Vogan JM., Smith MD., Gu Y., Cate JH., Nogales E. DIP original experiment: DIP-252302X Structure (London, England : 1993) 2013 IMEx Architecture of human translation initiation factor 3. Architecture of human translation initiation factor 3. Architecture of human translation initiation factor 3. Structure (London, England : 1993) 2013 imex curation Querol-Audi J., Sun C., Vogan JM., Smith MD., Gu Y., Cate JH., Nogales E. Only protein-protein interactions ecolx Escherichia coli pull down pull down weight by comassie molecular weight estimation by coomasie staining weight by comassie Querol-Audi J., Sun C., Vogan JM., Smith MD., Gu Y., Cate JH., Nogales E. DIP original experiment: DIP-252303X Structure (London, England : 1993) 2013 IMEx Architecture of human translation initiation factor 3. eif3h_human Eukaryotic translation initiation factor 3 subunit H EIF3S3 Eukaryotic translation initiation factor 3 subunit 3 eIF-3-gamma eIF3 p40 subunit EIF3H protein protein human Homo sapiens Human MASRKEGTGSTATSSSSTAGAAGKGKGKGGSGDSAVKQVQIDGLVVLKIIKHYQEEGQGTEVVQGVLLGLVVEDRLEITNCFPFPQHTEDDADFDEVQYQMEMMRSLRHVNIDHLHVGWYQSTYYGSFVTRALLDSQFSYQHAIEESVVLIYDPIKTAQGSLSLKAYRLTPKLMEVCKEKDFSPEALKKANITFEYMFEEVPIVIKNSHLINVLMWELEKKSAVADKHELLSLASSNHLGKNLQLLMDRVDEMSQDIVKYNTYMRNTSKQQQQKHQYQQRRQQENMQRQSRGEPPLPEEDLSKLFKPPQPPARMDSLLIAGQINTYCQNIKEFTAQNLGKLFMAQALQEYNN DIP protein O15372 original sequence version: 74 DIP protein O15372 original sequence version: 89 DIP protein O15372 original sequence version: 118 F3A6EFA0CEF587D0 eif3f_human Eukaryotic translation initiation factor 3 subunit F Eukaryotic translation initiation factor 3 subunit 5 eIF-3-epsilon eIF3 p47 EIF3F EIF3S5 Deubiquitinating enzyme eIF3f protein protein human Homo sapiens Human MATPAVPVSAPPATPTPVPAAAPASVPAPTPAPAAAPVPAAAPASSSDPAAAAAATAAPGQTPASAQAPAQTPAPALPGPALPGPFPGGRVVRLHPVILASIVDSYERRNEGAARVIGTLLGTVDKHSVEVTNCFSVPHNESEDEVAVDMEFAKNMYELHKKVSPNELILGWYATGHDITEHSVLIHEYYSREAPNPIHLTVDTSLQNGRMSIKAYVSTLMGVPGRTMGVMFTPLTVKYAYYDTERIGVDLIMKTCFSPNRVIGLSSDLQQVGGASARIQDALSTVLQYAEDVLSGKVSADNTVGRFLMSLVNQVPKIVPDDFETMLNSNINDLLMVTYLANLTQSQIALNEKLVNL DIP protein O00303 original sequence version: 142 DIP protein O00303 original sequence version: 80 DIP protein O00303 original sequence version: 95 DIP protein O00303 original sequence version: 126 8A70FC6E2BF07737 eif3j_human Eukaryotic translation initiation factor 3 subunit J EIF3J PRO0391 EIF3S1 Eukaryotic translation initiation factor 3 subunit 1 eIF-3-alpha eIF3 p35 protein protein human Homo sapiens Human MAAAAAAAGDSDSWDADAFSVEDPVRKVGGGGTAGGDRWEGEDEDEDVKDNWDDDDDEKKEEAEVKPEVKISEKKKIAEKIKEKERQQKKRQEEIKKRLEEPEEPKVLTPEEQLADKLRLKKLQEESDLELAKETFGVNNAVYGIDAMNPSSRDDFTEFGKLLKDKITQYEKSLYYASFLEVLVRDVCISLEIDDLKKITNSLTVLCSEKQKQEKQSKAKKKKKGVVPGGGLKATMKDDLADYGGYDGGYVQDYEDFM DIP protein O75822 original sequence version: 82 DIP protein O75822 original sequence version: 130 83624235424445AA eif3k_human Eukaryotic translation initiation factor 3 subunit K MSTP001 PTD001 HSPC029 EIF3K ARG134 EIF3S12 Eukaryotic translation initiation factor 3 subunit 12 eIF-3 p25 eIF-3 p28 Muscle-specific gene M9 protein PLAC-24 protein protein human Homo sapiens Human MAMFEQMRANVGKLLKGIDRYNPENLATLERYVETQAKENAYDLEANLAVLKLYQFNPAFFQTTVTAQILLKALTNLPHTDFTLCKCMIDQAHQEERPIRQILYLGDLLETCHFQAFWQALDENMDLLEGITGFEDSVRKFICHVVGITYQHIDRWLLAEMLGDLSDSQLKVWMSKYGWSADESGQIFICSQEESIKPKNIVEKIDFDSVSSIMASSQ DIP protein Q9UBQ5 original sequence version: 77 DIP protein Q9UBQ5 original sequence version: 92 DIP protein Q9UBQ5 original sequence version: 125 6B2CBBE8A9D1F28F eif3m_human Eukaryotic translation initiation factor 3 subunit M EIF3M HFLB5 PCID1 PCI domain-containing protein 1 Fetal lung protein B5 GA17 PNAS-125 protein protein human Homo sapiens Human MSVPAFIDISEEDQAAELRAYLKSKGAEISEENSEGGLHVDLAQIIEACDVCLKEDDKDVESVMNSVVSLLLILEPDKQEALIESLCEKLVKFREGERPSLRLQLLSNLFHGMDKNTPVRYTVYCSLIKVAASCGAIQYIPTELDQVRKWISDWNLTTEKKHTLLRLLYEALVDCKKSDAASKVMVELLGSYTEDNASQARVDAHRCIVRALKDPNAFLFDHLLTLKPVKFLEGELIHDLLTIFVSAKLASYVKFYQNNKDFIDSLGLLHEQNMAKMRLLTFMGMAVENKEISFDTMQQELQIGADDVEAFVIDAVRTKMVYCKIDQTQRKVVVSHSTHRTFGKQQWQQLYDTLNAWKQNLNKVKNSLLSLSDT DIP protein Q7L2H7 original sequence version: 33 DIP protein Q7L2H7 original sequence version: 48 DIP protein Q7L2H7 original sequence version: 79 63736CA2B093D794 eif1_human Eukaryotic translation initiation factor 1 Protein translation factor SUI1 homolog Sui1iso1 A121 EIF1 SUI1 protein protein human Homo sapiens Human MSAIQNLHSFDPFADASKGDDLLPAGTEDYIHIRIQQRNGRKTLTTVQGIADDYDKKKLVKAFKKKFACNGTVIEHPEYGEVIQLQGDQRKNICQFLVEIGLAKDDQLKVHGF DIP protein P41567 original sequence version: 114 A7BC7F9B53FFEB2C eif3c_human Eukaryotic translation initiation factor 3 subunit C EIF3C EIF3S8 Eukaryotic translation initiation factor 3 subunit 8 eIF3 p110 protein protein human Homo sapiens Human MSRFFTTGSDSESESSLSGEELVTKPVGGNYGKQPLLLSEDEEDTKRVVRSAKDKRFEELTNLIRTIRNAMKIRDVTKCLEEFELLGKAYGKAKSIVDKEGVPRFYIRILADLEDYLNELWEDKEGKKKMNKNNAKALSTLRQKIRKYNRDFESHITSYKQNPEQSADEDAEKNEEDSEGSSDEDEDEDGVSAATFLKKKSEAPSGESRKFLKKMDDEDEDSEDSEDDEDWDTGSTSSDSDSEEEEGKQTALASRFLKKAPTTDEDKKAAEKKREDKAKKKHDRKSKRLDEEEEDNEGGEWERVRGGVPLVKEKPKMFAKGTEITHAVVIKKLNEILQARGKKGTDRAAQIELLQLLVQIAAENNLGEGVIVKIKFNIIASLYDYNPNLATYMKPEMWGKCLDCINELMDILFANPNIFVGENILEESENLHNADQPLRVRGCILTLVERMDEEFTKIMQNTDPHSQEYVEHLKDEAQVCAIIERVQRYLEEKGTTEEVCRIYLLRILHTYYKFDYKAHQRQLTPPEGSSKSEQDQAENEGEDSAVLMERLCKYIYAKDRTDRIRTCAILCHIYHHALHSRWYQARDLMLMSHLQDNIQHADPPVQILYNRTMVQLGICAFRQGLTKDAHNALLDIQSSGRAKELLGQGLLLRSLQERNQEQEKVERRRQVPFHLHINLELLECVYLVSAMLLEIPYMAAHESDARRRMISKQFHHQLRVGERQPLLGPPESMREHVVAASKAMKMGDWKTCHSFIINEKMNGKVWDLFPEADKVRTMLVRKIQEESLRTYLFTYSSVYDSISMETLSDMFELDLPTVHSIISKMIINEELMASLDQPTQTVVMHRTEPTAQQNLALQLAEKLGSLVENNERVFDHKQGTYGGYFRDQKDGYRKNEGYMRRGGYRQQQSQTAY DIP protein Q99613 original sequence version: 92 DIP protein Q99613 original sequence version: 140 CE5029F4EB51C1AA if1ax_human Eukaryotic translation initiation factor 1A, X-chromosomal Eukaryotic translation initiation factor 4C EIF1AX EIF1A EIF4C protein protein human Homo sapiens Human MPKNKGKGGKNRRRGKNENESEKRELVFKEDGQEYAQVIKMLGNGRLEAMCFDGVKRLCHIRGKLRKKVWINTSDIILVGLRDYQDNKADVILKYNADEARSLKAYGELPEHAKINETDTFGPGDDDEIQFDDIGDDDEDIDDI DIP protein P47813 original sequence version: 131 1C4209855B21BFD4 eif3l_human Eukaryotic translation initiation factor 3 subunit L EIF3L HSPC021 HSPC025 EIF3S6IP Eukaryotic translation initiation factor 3 subunit 6-interacting protein MSTP005 EIF3EIP Eukaryotic translation initiation factor 3 subunit E-interacting protein protein protein human Homo sapiens Human MSYPADDYESEAAYDPYAYPSDYDMHTGDPKQDLAYERQYEQQTYQVIPEVIKNFIQYFHKTVSDLIDQKVYELQASRVSSDVIDQKVYEIQDIYENSWTKLTERFFKNTPWPEAEAIAPQVGNDAVFLILYKELYYRHIYAKVSGGPSLEQRFESYYNYCNLFNYILNADGPAPLELPNQWLWDIIDEFIYQFQSFSQYRCKTAKKSEEEIDFLRSNPKIWNVHSVLNVLHSLVDKSNINRQLEVYTSGGDPESVAGEYGRHSLYKMLGYFSLVGLLRLHSLLGDYYQAIKVLENIELNKKSMYSRVPECQVTTYYYVGFAYLMMRRYQDAIRVFANILLYIQRTKSMFQRTTYKYEMINKQNEQMHALLAIALTMYPMRIDESIHLQLREKYGDKMLRMQKGDPQVYEELFSYSCPKFLSPVVPNYDNVHPNYHKEPFLQQLKVFSDEVQQQAQLSTIRSFLKLYTTMPVAKLAGFLDLTEQEFRIQLLVFKHKMKNLVWTSGISALDGEFQSASEVDFYIDKDMIHIADTKVARRYGDFFIRQIHKFEELNRTLKKMGQRP DIP protein Q9Y262 original sequence version: 62 DIP protein Q9Y262 original sequence version: 78 DIP protein Q9Y262-1 original sequence version: 109 ECBD32192D96E3FE eif3e_human Eukaryotic translation initiation factor 3 subunit E EIF3E INT6 EIF3S6 Eukaryotic translation initiation factor 3 subunit 6 eIF-3 p48 Viral integration site protein INT-6 homolog protein protein human Homo sapiens Human MAEYDLTTRIAHFLDRHLVFPLLEFLSVKEIYNEKELLQGKLDLLSDTNMVDFAMDVYKNLYSDDIPHALREKRTTVVAQLKQLQAETEPIVKMFEDPETTRQMQSTRDGRMLFDYLADKHGFRQEYLDTLYRYAKFQYECGNYSGAAEYLYFFRVLVPATDRNALSSLWGKLASEILMQNWDAAMEDLTRLKETIDNNSVSSPLQSLQQRTWLIHWSLFVFFNHPKGRDNIIDLFLYQPQYLNAIQTMCPHILRYLTTAVITNKDVRKRRQVLKDLVKVIQQESYTYKDPITEFVECLYVNFDFDGAQKKLRECESVLVNDFFLVACLEDFIENARLFIFETFCRIHQCISINMLADKLNMTPEEAERWIVNLIRNARLDAKIDSKLGHVVMGNNAVSPYQQVIEKTKSLSFRSQMLAMNIEKKLNQNSRSEAPNWATQDSGFY DIP protein P60228 original sequence version: 120 DIP protein P60228 original sequence version: 60 DIP protein P60228 original sequence version: 76 DIP protein P60228 original sequence version: 111 A5368651DD0DDD0C eif3d_human Eukaryotic translation initiation factor 3 subunit D EIF3D EIF3S7 Eukaryotic translation initiation factor 3 subunit 7 eIF-3-zeta eIF3 p66 protein protein human Homo sapiens Human MAKFMTPVIQDNPSGWGPCAVPEQFRDMPYQPFSKGDRLGKVADWTGATYQDKRYTNKYSSQFGGGSQYAYFHEEDESSFQLVDTARTQKTAYQRNRMRFAQRNLRRDKDRRNMLQFNLQILPKSAKQKERERIRLQKKFQKQFGVRQKWDQKSQKPRDSSVEVRSDWEVKEEMDFPQLMKMRYLEVSEPQDIECCGALEYYDKAFDRITTRSEKPLRSIKRIFHTVTTTDDPVIRKLAKTQGNVFATDAILATLMSCTRSVYSWDIVVQRVGSKLFFDKRDNSDFDLLTVSETANEPPQDEGNSFNSPRNLAMEATYINHNFSQQCLRMGKERYNFPNPNPFVEDDMDKNEIASVAYRYRRWKLGDDIDLIVRCEHDGVMTGANGEVSFINIKTLNEWDSRHCNGVDWRQKLDSQRGAVIATELKNNSYKLARWTCCALLAGSEYLKLGYVSRYHVKDSSRHVILGTQQFKPNEFASQINLSVENAWGILRCVIDICMKLEEGKYLILKDPNKQVIRVYSLPDGTFSSDEDEEEEEEEEEEEEEEET DIP protein O15371 original sequence version: 79 DIP protein O15371 original sequence version: 121 7FE0448EC3BE1711 eif3a_human Eukaryotic translation initiation factor 3 subunit A EIF3A KIAA0139 EIF3S10 Eukaryotic translation initiation factor 3 subunit 10 eIF-3-theta eIF3 p167 eIF3 p180 eIF3 p185 protein protein human Homo sapiens Human MPAYFQRPENALKRANEFLEVGKKQPALDVLYDVMKSKKHRTWQKIHEPIMLKYLELCVDLRKSHLAKEGLYQYKNICQQVNIKSLEDVVRAYLKMAEEKTEAAKEESQQMVLDIEDLDNIQTPESVLLSAVSGEDTQDRTDRLLLTPWVKFLWESYRQCLDLLRNNSRVERLYHDIAQQAFKFCLQYTRKAEFRKLCDNLRMHLSQIQRHHNQSTAINLNNPESQSMHLETRLVQLDSAISMELWQEAFKAVEDIHGLFSLSKKPPKPQLMANYYNKVSTVFWKSGNALFHASTLHRLYHLSREMRKNLTQDEMQRMSTRVLLATLSIPITPERTDIARLLDMDGIIVEKQRRLATLLGLQAPPTRIGLINDMVRFNVLQYVVPEVKDLYNWLEVEFNPLKLCERVTKVLNWVREQPEKEPELQQYVPQLQNNTILRLLQQVSQIYQSIEFSRLTSLVPFVDAFQLERAIVDAARHCDLQVRIDHTSRTLSFGSDLNYATREDAPIGPHLQSMPSEQIRNQLTAMSSVLAKALEVIKPAHILQEKEEQHQLAVTAYLKNSRKEHQRILARRQTIEERKERLESLNIQREKEELEQREAELQKVRKAEEERLRQEAKEREKERILQEHEQIKKKTVRERLEQIKKTELGAKAFKDIDIEDLEELDPDFIMAKQVEQLEKEKKELQERLKNQEKKIDYFERAKRLEEIPLIKSAYEEQRIKDMDLWEQQEEERITTMQLEREKALEHKNRMSRMLEDRDLFVMRLKAARQSVYEEKLKQFEERLAEERHNRLEERKRQRKEERRITYYREKEEEEQRRAEEQMLKEREERERAERAKREEELREYQERVKKLEEVERKKRQRELEIEERERRREEERRLGDSSLSRKDSRWGDRDSEGTWRKGPEADSEWRRGPPEKEWRRGEGRDEDRSHRRDEERPRRLGDDEDREPSLRPDDDRVPRRGMDDDRGPRRGPEEDRFSRRGADDDRPSWRNTDDDRPPRRIADEDRGNWRHADDDRPPRRGLDEDRGSWRTADEDRGPRRGMDDDRGPRRGGADDERSSWRNADDDRGPRRGLDDDRGPRRGMDDDRGPRRGMDDDRGPRRGMDDDRGPRRGLDDDRGPWRNADDDRIPRRGAEDDRGPWRNMDDDRLSRRADDDRFPRRGDDSRPGPWRPLVKPGGWREKEKAREESWGPPRESRPSEEREWDREKERDRDNQDREENDKDPERERDRERDVDREDRFRRPRDEGGWRRGPAEESSSWRDSSRRDDRDRDDRRRERDDRRDLRERRDLRDDRDRRGPPLRSEREEVSSWRRADDRKDDRVEERDPPRRVPPPALSRDRERDRDREREGEKEKASWRAEKDRESLRRTKNETDEDGWTTVRR DIP protein Q14152 original sequence version: 79 DIP protein Q14152 original sequence version: 130 DIP protein Q14152 original sequence version: 111 DIP protein Q14152 original sequence version: 104 485C01B28D67EBBA eif1-eif3a-1 12 32 unspecified role unspecified role bait bait MBP-tag MBP-tag mbp tag maltose binding protein tag maltose binding protein tag maltose binding protein tag mbp tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range ecolx Escherichia coli 33 unspecified role unspecified role prey prey Region 302-913 Region 302-913 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain ecolx Escherichia coli 38 unspecified role unspecified role prey prey Region 5-654 Region 5-654 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain ecolx Escherichia coli association association eif3e-eif3a-1 9 31 unspecified role unspecified role prey prey ecolx Escherichia coli 35 unspecified role unspecified role prey prey ecolx Escherichia coli 30 unspecified role unspecified role prey prey ecolx Escherichia coli 27 unspecified role unspecified role prey prey ecolx Escherichia coli 28 unspecified role unspecified role prey prey ecolx Escherichia coli 36 unspecified role unspecified role bait bait His-tag His-tag his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range ecolx Escherichia coli 33 unspecified role unspecified role prey prey Region 302-913 Region 302-913 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain ecolx Escherichia coli 38 unspecified role unspecified role prey prey Region 5-654 Region 5-654 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain ecolx Escherichia coli association association eif3a-eif3c-1 1 31 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli 35 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli 30 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli 27 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli 28 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli 36 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli 33 unspecified role unspecified role unspecified role unspecified role Region 302-913 Region 302-913 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain ecolx Escherichia coli 38 unspecified role unspecified role unspecified role unspecified role Region 5-654 Region 5-654 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain ecolx Escherichia coli physical association physical association eif3a-eif3c-2 15 33 unspecified role unspecified role unspecified role unspecified role Region 302-913 Region 302-913 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain ecolx Escherichia coli 38 unspecified role unspecified role unspecified role unspecified role Region 5-654 Region 5-654 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain ecolx Escherichia coli direct interaction direct interaction eif3a-eif3c-3 11 31 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli 35 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli 30 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli 27 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli 28 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli 36 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli 33 unspecified role unspecified role unspecified role unspecified role Region 302-913 Region 302-913 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain ecolx Escherichia coli 38 unspecified role unspecified role unspecified role unspecified role Region 5-654 Region 5-654 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain ecolx Escherichia coli association association eif3m-eif3a-1 2 31 unspecified role unspecified role bait bait His-tag His-tag his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range ecolx Escherichia coli 35 unspecified role unspecified role prey prey ecolx Escherichia coli 30 unspecified role unspecified role prey prey ecolx Escherichia coli 27 unspecified role unspecified role prey prey ecolx Escherichia coli 28 unspecified role unspecified role prey prey ecolx Escherichia coli 36 unspecified role unspecified role prey prey ecolx Escherichia coli 33 unspecified role unspecified role prey prey Region 302-913 Region 302-913 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain ecolx Escherichia coli 38 unspecified role unspecified role prey prey Region 5-654 Region 5-654 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain ecolx Escherichia coli association association eif3a-eif3c-4 8 29 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli 31 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli 35 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli 30 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli 27 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli 28 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli 36 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli 33 unspecified role unspecified role unspecified role unspecified role Region 302-913 Region 302-913 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain ecolx Escherichia coli 38 unspecified role unspecified role unspecified role unspecified role Region 5-654 Region 5-654 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain ecolx Escherichia coli physical association physical association eif3a-eif3c-5 13 29 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli 31 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli 35 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli 30 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli 27 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli 28 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli 36 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli 33 unspecified role unspecified role unspecified role unspecified role Region 302-913 Region 302-913 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain ecolx Escherichia coli 38 unspecified role unspecified role unspecified role unspecified role Region 5-654 Region 5-654 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain ecolx Escherichia coli physical association physical association eif1-eif3c-1 19 32 unspecified role unspecified role bait bait MBP-tag MBP-tag mbp tag maltose binding protein tag maltose binding protein tag maltose binding protein tag mbp tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range ecolx Escherichia coli 33 unspecified role unspecified role prey prey Region 302-913 Region 302-913 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain ecolx Escherichia coli direct interaction direct interaction eif3a-eif3c-6 17 31 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli 35 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli 30 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli 27 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli 28 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli 36 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli 33 unspecified role unspecified role unspecified role unspecified role Region 302-913 Region 302-913 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain ecolx Escherichia coli 38 unspecified role unspecified role unspecified role unspecified role Region 5-654 Region 5-654 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain ecolx Escherichia coli physical association physical association eif3a-eif3c-7 26 31 unspecified role unspecified role prey prey ecolx Escherichia coli 35 unspecified role unspecified role prey prey ecolx Escherichia coli 30 unspecified role unspecified role prey prey ecolx Escherichia coli 27 unspecified role unspecified role prey prey ecolx Escherichia coli 28 unspecified role unspecified role prey prey ecolx Escherichia coli 36 unspecified role unspecified role prey prey ecolx Escherichia coli 33 unspecified role unspecified role prey prey Region 302-913 Region 302-913 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain ecolx Escherichia coli 38 unspecified role unspecified role bait bait His-tag His-tag his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range Region 5-654 Region 5-654 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain ecolx Escherichia coli association association eif3a-eif3c-8 10 37 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli 31 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli 35 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli 30 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli 27 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli 28 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli 36 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli 33 unspecified role unspecified role unspecified role unspecified role Region 302-913 Region 302-913 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain ecolx Escherichia coli 38 unspecified role unspecified role unspecified role unspecified role Region 5-654 Region 5-654 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain ecolx Escherichia coli physical association physical association eif3l-eif3a-1 23 31 unspecified role unspecified role prey prey ecolx Escherichia coli 35 unspecified role unspecified role bait bait His-tag His-tag his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range ecolx Escherichia coli 30 unspecified role unspecified role prey prey ecolx Escherichia coli 27 unspecified role unspecified role prey prey ecolx Escherichia coli 28 unspecified role unspecified role prey prey ecolx Escherichia coli 36 unspecified role unspecified role prey prey ecolx Escherichia coli 33 unspecified role unspecified role prey prey Region 302-913 Region 302-913 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain ecolx Escherichia coli 38 unspecified role unspecified role prey prey Region 5-654 Region 5-654 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain ecolx Escherichia coli association association eif1-eif3a-2 20 32 unspecified role unspecified role bait bait MBP-tag MBP-tag mbp tag maltose binding protein tag maltose binding protein tag maltose binding protein tag mbp tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range ecolx Escherichia coli 38 unspecified role unspecified role prey prey Region 5-654 Region 5-654 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain ecolx Escherichia coli direct interaction direct interaction eif3j-eif3a-1 22 29 unspecified role unspecified role bait bait GST-tag GST-tag gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range ecolx Escherichia coli 31 unspecified role unspecified role prey prey ecolx Escherichia coli 35 unspecified role unspecified role prey prey ecolx Escherichia coli 30 unspecified role unspecified role prey prey ecolx Escherichia coli 27 unspecified role unspecified role prey prey ecolx Escherichia coli 28 unspecified role unspecified role prey prey ecolx Escherichia coli 36 unspecified role unspecified role prey prey ecolx Escherichia coli 33 unspecified role unspecified role prey prey Region 302-913 Region 302-913 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain ecolx Escherichia coli 38 unspecified role unspecified role prey prey Region 5-654 Region 5-654 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain ecolx Escherichia coli association association eif1ax-eif3a-1 21 34 unspecified role unspecified role bait bait MBP-tag MBP-tag mbp tag maltose binding protein tag maltose binding protein tag maltose binding protein tag mbp tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range ecolx Escherichia coli 38 unspecified role unspecified role prey prey Region 5-654 Region 5-654 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain ecolx Escherichia coli direct interaction direct interaction eif3h-eif3a-1 24 31 unspecified role unspecified role prey prey ecolx Escherichia coli 35 unspecified role unspecified role prey prey ecolx Escherichia coli 30 unspecified role unspecified role prey prey ecolx Escherichia coli 27 unspecified role unspecified role bait bait His-tag His-tag his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range ecolx Escherichia coli 28 unspecified role unspecified role prey prey ecolx Escherichia coli 36 unspecified role unspecified role prey prey ecolx Escherichia coli 33 unspecified role unspecified role prey prey Region 302-913 Region 302-913 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain ecolx Escherichia coli 38 unspecified role unspecified role prey prey Region 5-654 Region 5-654 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain ecolx Escherichia coli association association eif3a-eif3c-9 16 37 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli 31 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli 35 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli 30 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli 27 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli 28 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli 36 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli 33 unspecified role unspecified role unspecified role unspecified role Region 302-913 Region 302-913 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain ecolx Escherichia coli 38 unspecified role unspecified role unspecified role unspecified role Region 5-654 Region 5-654 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain ecolx Escherichia coli physical association physical association eif3a-eif3c-10 6 29 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli 31 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli 35 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli 30 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli 27 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli 28 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli 36 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli 33 unspecified role unspecified role unspecified role unspecified role Region 302-913 Region 302-913 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain ecolx Escherichia coli 38 unspecified role unspecified role unspecified role unspecified role Region 5-654 Region 5-654 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain ecolx Escherichia coli physical association physical association eif1ax-eif3a-2 14 34 unspecified role unspecified role bait bait MBP-tag MBP-tag mbp tag maltose binding protein tag maltose binding protein tag maltose binding protein tag mbp tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range ecolx Escherichia coli 33 unspecified role unspecified role prey prey Region 302-913 Region 302-913 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain ecolx Escherichia coli 38 unspecified role unspecified role prey prey Region 5-654 Region 5-654 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain ecolx Escherichia coli association association eif3f-eif3a-1 4 31 unspecified role unspecified role prey prey ecolx Escherichia coli 35 unspecified role unspecified role prey prey ecolx Escherichia coli 30 unspecified role unspecified role prey prey ecolx Escherichia coli 27 unspecified role unspecified role prey prey ecolx Escherichia coli 28 unspecified role unspecified role bait bait His-tag His-tag his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range ecolx Escherichia coli 36 unspecified role unspecified role prey prey ecolx Escherichia coli 33 unspecified role unspecified role prey prey Region 302-913 Region 302-913 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain ecolx Escherichia coli 38 unspecified role unspecified role prey prey Region 5-654 Region 5-654 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain ecolx Escherichia coli association association eif3d-eif3a-1 7 37 unspecified role unspecified role bait bait GST-tag GST-tag gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range ecolx Escherichia coli 31 unspecified role unspecified role prey prey ecolx Escherichia coli 35 unspecified role unspecified role prey prey ecolx Escherichia coli 30 unspecified role unspecified role prey prey ecolx Escherichia coli 27 unspecified role unspecified role prey prey ecolx Escherichia coli 28 unspecified role unspecified role prey prey ecolx Escherichia coli 36 unspecified role unspecified role prey prey ecolx Escherichia coli 33 unspecified role unspecified role prey prey Region 302-913 Region 302-913 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain ecolx Escherichia coli 38 unspecified role unspecified role prey prey Region 5-654 Region 5-654 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain ecolx Escherichia coli association association eif3a-eif3c-11 18 37 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli 31 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli 35 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli 30 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli 27 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli 28 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli 36 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli 33 unspecified role unspecified role unspecified role unspecified role Region 302-913 Region 302-913 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain ecolx Escherichia coli 38 unspecified role unspecified role unspecified role unspecified role Region 5-654 Region 5-654 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain ecolx Escherichia coli physical association physical association eif1ax-eif3c-1 3 34 unspecified role unspecified role bait bait MBP-tag MBP-tag mbp tag maltose binding protein tag maltose binding protein tag maltose binding protein tag mbp tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range ecolx Escherichia coli 33 unspecified role unspecified role prey prey Region 302-913 Region 302-913 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain ecolx Escherichia coli direct interaction direct interaction eif3a-eif3c-12 25 31 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli 35 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli 30 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli 27 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli 28 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli 36 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli 33 unspecified role unspecified role unspecified role unspecified role Region 302-913 Region 302-913 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain ecolx Escherichia coli 38 unspecified role unspecified role unspecified role unspecified role Region 5-654 Region 5-654 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain ecolx Escherichia coli physical association physical association eif3k-eif3a-1 5 31 unspecified role unspecified role prey prey ecolx Escherichia coli 35 unspecified role unspecified role prey prey ecolx Escherichia coli 30 unspecified role unspecified role bait bait His-tag His-tag his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range ecolx Escherichia coli 27 unspecified role unspecified role prey prey ecolx Escherichia coli 28 unspecified role unspecified role prey prey ecolx Escherichia coli 36 unspecified role unspecified role prey prey ecolx Escherichia coli 33 unspecified role unspecified role prey prey Region 302-913 Region 302-913 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain ecolx Escherichia coli 38 unspecified role unspecified role prey prey Region 5-654 Region 5-654 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain ecolx Escherichia coli association association