DIP Database of Interacting Proteins 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ dip@mbi.ucla.edu Interaction with Shc prevents aberrant Erk activation in the absence of extracellular stimuli. Interaction with Shc prevents aberrant Erk activation in the absence of extracellular stimuli. Nature structural & molecular biology 2013 imex curation Suen KM., Lin CC., George R., Melo FA., Biggs ER., Ahmed Z., Drake MN., Arur S., Arold ST., Ladbury JE. Only protein-protein interactions in vitro In vitro itc isothermal titration calorimetry ITC ITC itc predetermined predetermined participant predetermined Suen KM., Lin CC., George R., Melo FA., Biggs ER., Ahmed Z., Drake MN., Arur S., Arold ST., Ladbury JE. DIP original experiment: DIP-255621X Nature structural & molecular biology 2013 IMEx Interaction with Shc prevents aberrant Erk activation in the absence of extracellular stimuli. Interaction with Shc prevents aberrant Erk activation in the absence of extracellular stimuli. Interaction with Shc prevents aberrant Erk activation in the absence of extracellular stimuli. Nature structural & molecular biology 2013 imex curation Suen KM., Lin CC., George R., Melo FA., Biggs ER., Ahmed Z., Drake MN., Arur S., Arold ST., Ladbury JE. Only protein-protein interactions in vitro In vitro saxs x ray scattering saxs predetermined predetermined participant predetermined Suen KM., Lin CC., George R., Melo FA., Biggs ER., Ahmed Z., Drake MN., Arur S., Arold ST., Ladbury JE. DIP original experiment: DIP-255624X Nature structural & molecular biology 2013 IMEx Interaction with Shc prevents aberrant Erk activation in the absence of extracellular stimuli. Interaction with Shc prevents aberrant Erk activation in the absence of extracellular stimuli. Interaction with Shc prevents aberrant Erk activation in the absence of extracellular stimuli. Nature structural & molecular biology 2013 imex curation Suen KM., Lin CC., George R., Melo FA., Biggs ER., Ahmed Z., Drake MN., Arur S., Arold ST., Ladbury JE. Only protein-protein interactions in vitro In vitro itc isothermal titration calorimetry ITC ITC itc predetermined predetermined participant predetermined Suen KM., Lin CC., George R., Melo FA., Biggs ER., Ahmed Z., Drake MN., Arur S., Arold ST., Ladbury JE. DIP original experiment: DIP-255622X Nature structural & molecular biology 2013 IMEx Interaction with Shc prevents aberrant Erk activation in the absence of extracellular stimuli. Interaction with Shc prevents aberrant Erk activation in the absence of extracellular stimuli. Interaction with Shc prevents aberrant Erk activation in the absence of extracellular stimuli. Nature structural & molecular biology 2013 imex curation Suen KM., Lin CC., George R., Melo FA., Biggs ER., Ahmed Z., Drake MN., Arur S., Arold ST., Ladbury JE. Only protein-protein interactions in vitro In vitro pull down pull down western blot western blot Immuno blot Immuno blot Suen KM., Lin CC., George R., Melo FA., Biggs ER., Ahmed Z., Drake MN., Arur S., Arold ST., Ladbury JE. DIP original experiment: DIP-255620X Nature structural & molecular biology 2013 IMEx Interaction with Shc prevents aberrant Erk activation in the absence of extracellular stimuli. Interaction with Shc prevents aberrant Erk activation in the absence of extracellular stimuli. Interaction with Shc prevents aberrant Erk activation in the absence of extracellular stimuli. Nature structural & molecular biology 2013 imex curation Suen KM., Lin CC., George R., Melo FA., Biggs ER., Ahmed Z., Drake MN., Arur S., Arold ST., Ladbury JE. Only protein-protein interactions in vitro In vitro fret fluorescent resonance energy transfer FRET RET FRET analysis FRET RET FRET analysis fret predetermined predetermined participant predetermined Suen KM., Lin CC., George R., Melo FA., Biggs ER., Ahmed Z., Drake MN., Arur S., Arold ST., Ladbury JE. DIP original experiment: DIP-255623X Nature structural & molecular biology 2013 IMEx Interaction with Shc prevents aberrant Erk activation in the absence of extracellular stimuli. Interaction with Shc prevents aberrant Erk activation in the absence of extracellular stimuli. Interaction with Shc prevents aberrant Erk activation in the absence of extracellular stimuli. Nature structural & molecular biology 2013 imex curation Suen KM., Lin CC., George R., Melo FA., Biggs ER., Ahmed Z., Drake MN., Arur S., Arold ST., Ladbury JE. Only protein-protein interactions in vitro In vitro pull down pull down anti tag western anti tag western blot anti tag western Suen KM., Lin CC., George R., Melo FA., Biggs ER., Ahmed Z., Drake MN., Arur S., Arold ST., Ladbury JE. DIP original experiment: DIP-255625X Nature structural & molecular biology 2013 IMEx Interaction with Shc prevents aberrant Erk activation in the absence of extracellular stimuli. p29353-2 SHC-transforming protein 1 SHC1 SHC SHCA SHC-transforming protein 3 SHC-transforming protein A Src homology 2 domain-containing-transforming protein C1 protein protein human Homo sapiens Human MNKLSGGGGRRTRVEGGQLGGEEWTRHGSFVNKPTRGWLHPNDKVMGPGVSYLVRYMGCVEVLQSMRALDFNTRTQVTREAISLVCEAVPGAKGATRRRKPCSRPLSSILGRSNLKFAGMPITLTVSTSSLNLMAADCKQIIANHHMQSISFASGGDPDTAEYVAYVAKDPVNQRACHILECPEGLAQDVISTIGQAFELRFKQYLRNPPKLVTPHDRMAGFDGSAWDEEEEEPPDHQYYNDFPGKEPPLGGVVDMRLREGAAPGAARPTAPNAQTPSHLGATLPVGQPVGGDPEVRKQMPPPPPCPGRELFDDPSYVNVQNLDKARQAVGGAGPPNPAINGSAPRDLFDMKPFEDALRVPPPPQSVSMAEQLRGEPWFHGKLSRREAEALLQLNGDFLVRESTTTPGQYVLTGLQSGQPKHLLLVDPEGVVRTKDHRFESVSHLISYHMDNHLPIISAGSELCLQQPVERKL Contains a N-acetylmethionine at position 1. DIP protein P29353-2 original sequence version: 161 6DDC519E3F318B6D p39745-1 Mitogen-activated protein kinase mpk-1 MAP kinase sur-1 sur-1 F43C1.2 mpk-1 protein protein caeel Caenorhabditis elegans MPTWIPNNLCAQPTTRNAKPPSNGHPQATQQQSAPGSLAYRNSSNIPNGATNHVRQQKWQYTRSGHRKMADGEAVISTVNNVEEVHGQLFEVAPRYVNLSYIGEGAYGMVASALDTITRDRVAIKKISPFEHQTFCQRTLREIKILNRFKHENIINIQEIIRSETVDSLKDIYIVQCLMETDLYKLLKTQKLSNDHVCYFLYQILRGLKYIHSANVLHRDLKPSNLLLNTTCDLKICDFGLARVTDPQTDHTGFLTEYVATRWYRAPEIMLNSKGYTKSIDVWSVGCILAEMLSNRPLFPGKHYLDQLNLILAVVGSPSNADLQCIINDKARSYLISLPHKPKQPWARLYPGADPRALDLLDKMLTFNPHNRIDIEQALAHPYLEQYYDPGDEPVCEEPFTLEMEFDDLPKEKLKELIWEEAEAHHRRMEAEAAARNNGGQNPV DIP protein P39745-1 original sequence version: 122 11BA27D17641980D shc1_human SHC-transforming protein 1 SHC1 SHC SHCA Src homology 2 domain-containing-transforming protein C1 SHC-transforming protein A SHC-transforming protein 3 protein protein human Homo sapiens Human MDLLPPKPKYNPLRNESLSSLEEGASGSTPPEELPSPSASSLGPILPPLPGDDSPTTLCSFFPRMSNLRLANPAGGRPGSKGEPGRAADDGEGIVGAAMPDSGPLPLLQDMNKLSGGGGRRTRVEGGQLGGEEWTRHGSFVNKPTRGWLHPNDKVMGPGVSYLVRYMGCVEVLQSMRALDFNTRTQVTREAISLVCEAVPGAKGATRRRKPCSRPLSSILGRSNLKFAGMPITLTVSTSSLNLMAADCKQIIANHHMQSISFASGGDPDTAEYVAYVAKDPVNQRACHILECPEGLAQDVISTIGQAFELRFKQYLRNPPKLVTPHDRMAGFDGSAWDEEEEEPPDHQYYNDFPGKEPPLGGVVDMRLREGAAPGAARPTAPNAQTPSHLGATLPVGQPVGGDPEVRKQMPPPPPCPGRELFDDPSYVNVQNLDKARQAVGGAGPPNPAINGSAPRDLFDMKPFEDALRVPPPPQSVSMAEQLRGEPWFHGKLSRREAEALLQLNGDFLVRESTTTPGQYVLTGLQSGQPKHLLLVDPEGVVRTKDHRFESVSHLISYHMDNHLPIISAGSELCLQQPVERKL DIP protein P29353 original sequence version: 161 DIP protein P29353 original sequence version: 190 7EFA5CB185A548D1 mk01_human Mitogen-activated protein kinase 1 MAPK1 ERK2 PRKM1 Extracellular signal-regulated kinase 2 Mitogen-activated protein kinase 2 MAP kinase isoform p42 ERT1 PRKM2 protein protein human Homo sapiens Human MAAAAAAGAGPEMVRGQVFDVGPRYTNLSYIGEGAYGMVCSAYDNVNKVRVAIKKISPFEHQTYCQRTLREIKILLRFRHENIIGINDIIRAPTIEQMKDVYIVQDLMETDLYKLLKTQHLSNDHICYFLYQILRGLKYIHSANVLHRDLKPSNLLLNTTCDLKICDFGLARVADPDHDHTGFLTEYVATRWYRAPEIMLNSKGYTKSIDIWSVGCILAEMLSNRPIFPGKHYLDQLNHILGILGSPSQEDLNCIINLKARNYLLSLPHKNKVPWNRLFPNADSKALDLLDKMLTFNPHKRIEVEQALAHPYLEQYYDPSDEPIAEAPFKFDMELDDLPKEKLKELIFEETARFQPGYRS DIP protein P28482 original sequence version: 173 DIP protein P28482 original sequence version: 103 DIP protein P28482 original sequence version: 101 DIP protein P28482 original sequence version: 131 DIP protein P28482 original sequence version: 156 DIP protein P28482 original sequence version: 166 DIP protein P28482 original sequence version: 144 E85D0B2A5D2D724E mapk1-shc1-1 4 9 unspecified role unspecified role prey prey human Homo sapiens Human 10 unspecified role unspecified role bait bait P28482:p.[Asp20Ala;Asp100Ala] D20A/D100A mutation disrupting strength mutation disrupting interaction strength mutation disrupting strength alanine scanning alanine scanning certain certain sequence position certain certain certain sequence position certain D A certain certain sequence position certain certain certain sequence position certain D A This feature has been corrected as a result of our quality control procedures. The original label was 'D20A/D100A'. Wed May 02 15:13:04 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'asp20ala,asp100ala' Tue Jun 30 19:33:51 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.[Asp20Ala;Asp100Ala]' GST-tag GST-tag gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range ecolx Escherichia coli physical association physical association mapk1-shc1-2 3 7 unspecified role unspecified role unspecified role unspecified role Region 97-107 Region 97-107 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain in vitro In vitro 10 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli direct interaction direct interaction mapk1-shc1-3 2 7 unspecified role unspecified role unspecified role unspecified role Region 1-207 Region 1-207 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain ecolx Escherichia coli 10 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli direct interaction direct interaction mpk_1-shc1-1 6 7 unspecified role unspecified role prey prey Strep-tag Strep-tag strep tag strep tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined human Homo sapiens Human 8 unspecified role unspecified role bait bait GST-tag GST-tag gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined ecolx Escherichia coli physical association physical association shc1-mapk1-1 5 7 unspecified role unspecified role fluorescence donor fluorescence donor Region 1-207 Region 1-207 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain BFP-tag BFP-tag fluorescent prot tag fluorescent protein tag fluorescent prot tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined ecolx Escherichia coli 10 unspecified role unspecified role fluorescence accept fluorescence acceptor fluorescence accept GFP-tag GFP-tag gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range ecolx Escherichia coli direct interaction direct interaction mapk1-shc1-4 1 7 unspecified role unspecified role unspecified role unspecified role Region 1-207 Region 1-207 sufficient to bind sufficient binding region sufficient to bind deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain ecolx Escherichia coli 10 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli direct interaction direct interaction