DIP Database of Interacting Proteins 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ dip@mbi.ucla.edu Structural mechanism of CCM3 heterodimerization with GCKIII kinases. Structural mechanism of CCM3 heterodimerization with GCKIII kinases. Structure (London, England : 1993) 2013 imex curation Zhang M., Dong L., Shi Z., Jiao S., Zhang Z., Zhang W., Liu G., Chen C., Feng M., Hao Q., Wang W., Yin M., Zhao Y., Zhang L., Zhou Z. Only protein-protein interactions in vitro In vitro bio-layer interferometry bio-layer interferometry bli bli predetermined predetermined participant predetermined Zhang M., Dong L., Shi Z., Jiao S., Zhang Z., Zhang W., Liu G., Chen C., Feng M., Hao Q., Wang W., Yin M., Zhao Y., Zhang L., Zhou Z. DIP original experiment: DIP-252253X Structure (London, England : 1993) 2013 IMEx Structural mechanism of CCM3 heterodimerization with GCKIII kinases. Structural mechanism of CCM3 heterodimerization with GCKIII kinases. Structural mechanism of CCM3 heterodimerization with GCKIII kinases. Structure (London, England : 1993) 2013 imex curation Zhang M., Dong L., Shi Z., Jiao S., Zhang Z., Zhang W., Liu G., Chen C., Feng M., Hao Q., Wang W., Yin M., Zhao Y., Zhang L., Zhou Z. Only protein-protein interactions human Homo sapiens Human anti tag coip anti tag coimmunoprecipitation anti tag coip anti tag western anti tag western blot anti tag western Zhang M., Dong L., Shi Z., Jiao S., Zhang Z., Zhang W., Liu G., Chen C., Feng M., Hao Q., Wang W., Yin M., Zhao Y., Zhang L., Zhou Z. DIP original experiment: DIP-252254X Structure (London, England : 1993) 2013 IMEx Structural mechanism of CCM3 heterodimerization with GCKIII kinases. Structural mechanism of CCM3 heterodimerization with GCKIII kinases. Structural mechanism of CCM3 heterodimerization with GCKIII kinases. Structure (London, England : 1993) 2013 imex curation Zhang M., Dong L., Shi Z., Jiao S., Zhang Z., Zhang W., Liu G., Chen C., Feng M., Hao Q., Wang W., Yin M., Zhao Y., Zhang L., Zhou Z. Only protein-protein interactions in vitro In vitro molecular sieving molecular sieving Gel Filtration Size Exclusion Chromatography Size Exclusion Chromatography Gel Filtration Sizing column weight by comassie molecular weight estimation by coomasie staining weight by comassie Zhang M., Dong L., Shi Z., Jiao S., Zhang Z., Zhang W., Liu G., Chen C., Feng M., Hao Q., Wang W., Yin M., Zhao Y., Zhang L., Zhou Z. DIP original experiment: DIP-252256X Structure (London, England : 1993) 2013 IMEx Structural mechanism of CCM3 heterodimerization with GCKIII kinases. Structural mechanism of CCM3 heterodimerization with GCKIII kinases. Structural mechanism of CCM3 heterodimerization with GCKIII kinases. Structure (London, England : 1993) 2013 imex curation Zhang M., Dong L., Shi Z., Jiao S., Zhang Z., Zhang W., Liu G., Chen C., Feng M., Hao Q., Wang W., Yin M., Zhao Y., Zhang L., Zhou Z. Only protein-protein interactions ecolx Escherichia coli x-ray diffraction x-ray crystallography X-ray X-ray x-ray diffraction predetermined predetermined participant predetermined Zhang M., Dong L., Shi Z., Jiao S., Zhang Z., Zhang W., Liu G., Chen C., Feng M., Hao Q., Wang W., Yin M., Zhao Y., Zhang L., Zhou Z. DIP original experiment: DIP-252250X Structure (London, England : 1993) 2013 IMEx Structural mechanism of CCM3 heterodimerization with GCKIII kinases. Structural mechanism of CCM3 heterodimerization with GCKIII kinases. Structural mechanism of CCM3 heterodimerization with GCKIII kinases. Structure (London, England : 1993) 2013 imex curation Zhang M., Dong L., Shi Z., Jiao S., Zhang Z., Zhang W., Liu G., Chen C., Feng M., Hao Q., Wang W., Yin M., Zhao Y., Zhang L., Zhou Z. Only protein-protein interactions in vitro In vitro bio-layer interferometry bio-layer interferometry bli bli predetermined predetermined participant predetermined Zhang M., Dong L., Shi Z., Jiao S., Zhang Z., Zhang W., Liu G., Chen C., Feng M., Hao Q., Wang W., Yin M., Zhao Y., Zhang L., Zhou Z. DIP original experiment: DIP-252252X Structure (London, England : 1993) 2013 IMEx Structural mechanism of CCM3 heterodimerization with GCKIII kinases. Structural mechanism of CCM3 heterodimerization with GCKIII kinases. Structural mechanism of CCM3 heterodimerization with GCKIII kinases. Structure (London, England : 1993) 2013 imex curation Zhang M., Dong L., Shi Z., Jiao S., Zhang Z., Zhang W., Liu G., Chen C., Feng M., Hao Q., Wang W., Yin M., Zhao Y., Zhang L., Zhou Z. Only protein-protein interactions in vitro In vitro bio-layer interferometry bio-layer interferometry bli bli predetermined predetermined participant predetermined Zhang M., Dong L., Shi Z., Jiao S., Zhang Z., Zhang W., Liu G., Chen C., Feng M., Hao Q., Wang W., Yin M., Zhao Y., Zhang L., Zhou Z. DIP original experiment: DIP-252257X Structure (London, England : 1993) 2013 IMEx Structural mechanism of CCM3 heterodimerization with GCKIII kinases. Structural mechanism of CCM3 heterodimerization with GCKIII kinases. Structural mechanism of CCM3 heterodimerization with GCKIII kinases. Structure (London, England : 1993) 2013 imex curation Zhang M., Dong L., Shi Z., Jiao S., Zhang Z., Zhang W., Liu G., Chen C., Feng M., Hao Q., Wang W., Yin M., Zhao Y., Zhang L., Zhou Z. Only protein-protein interactions ecolx Escherichia coli molecular sieving molecular sieving Gel Filtration Size Exclusion Chromatography Size Exclusion Chromatography Gel Filtration Sizing column predetermined predetermined participant predetermined Zhang M., Dong L., Shi Z., Jiao S., Zhang Z., Zhang W., Liu G., Chen C., Feng M., Hao Q., Wang W., Yin M., Zhao Y., Zhang L., Zhou Z. DIP original experiment: DIP-252251X Structure (London, England : 1993) 2013 IMEx Structural mechanism of CCM3 heterodimerization with GCKIII kinases. Structural mechanism of CCM3 heterodimerization with GCKIII kinases. Structural mechanism of CCM3 heterodimerization with GCKIII kinases. Structure (London, England : 1993) 2013 imex curation Zhang M., Dong L., Shi Z., Jiao S., Zhang Z., Zhang W., Liu G., Chen C., Feng M., Hao Q., Wang W., Yin M., Zhao Y., Zhang L., Zhou Z. Only protein-protein interactions human Homo sapiens Human anti tag coip anti tag coimmunoprecipitation anti tag coip anti tag western anti tag western blot anti tag western Zhang M., Dong L., Shi Z., Jiao S., Zhang Z., Zhang W., Liu G., Chen C., Feng M., Hao Q., Wang W., Yin M., Zhao Y., Zhang L., Zhou Z. DIP original experiment: DIP-252255X Structure (London, England : 1993) 2013 IMEx Structural mechanism of CCM3 heterodimerization with GCKIII kinases. Structural mechanism of CCM3 heterodimerization with GCKIII kinases. Structural mechanism of CCM3 heterodimerization with GCKIII kinases. Structure (London, England : 1993) 2013 imex curation Zhang M., Dong L., Shi Z., Jiao S., Zhang Z., Zhang W., Liu G., Chen C., Feng M., Hao Q., Wang W., Yin M., Zhao Y., Zhang L., Zhou Z. Only protein-protein interactions in vitro In vitro pull down pull down weight by comassie molecular weight estimation by coomasie staining weight by comassie Zhang M., Dong L., Shi Z., Jiao S., Zhang Z., Zhang W., Liu G., Chen C., Feng M., Hao Q., Wang W., Yin M., Zhao Y., Zhang L., Zhou Z. DIP original experiment: DIP-252259X Structure (London, England : 1993) 2013 IMEx Structural mechanism of CCM3 heterodimerization with GCKIII kinases. Structural mechanism of CCM3 heterodimerization with GCKIII kinases. Structural mechanism of CCM3 heterodimerization with GCKIII kinases. Structure (London, England : 1993) 2013 imex curation Zhang M., Dong L., Shi Z., Jiao S., Zhang Z., Zhang W., Liu G., Chen C., Feng M., Hao Q., Wang W., Yin M., Zhao Y., Zhang L., Zhou Z. Only protein-protein interactions in vitro In vitro pull down pull down weight by comassie molecular weight estimation by coomasie staining weight by comassie Zhang M., Dong L., Shi Z., Jiao S., Zhang Z., Zhang W., Liu G., Chen C., Feng M., Hao Q., Wang W., Yin M., Zhao Y., Zhang L., Zhou Z. DIP original experiment: DIP-252258X Structure (London, England : 1993) 2013 IMEx Structural mechanism of CCM3 heterodimerization with GCKIII kinases. stk24_human Serine/threonine-protein kinase 24 STK24 MST3 STK3 STE20-like kinase MST3 Mammalian STE20-like protein kinase 3 protein protein human Homo sapiens Human MDSRAQLWGLALNKRRATLPHPGGSTNLKADPEELFTKLEKIGKGSFGEVFKGIDNRTQKVVAIKIIDLEEAEDEIEDIQQEITVLSQCDSPYVTKYYGSYLKDTKLWIIMEYLGGGSALDLLEPGPLDETQIATILREILKGLDYLHSEKKIHRDIKAANVLLSEHGEVKLADFGVAGQLTDTQIKRNTFVGTPFWMAPEVIKQSAYDSKADIWSLGITAIELARGEPPHSELHPMKVLFLIPKNNPPTLEGNYSKPLKEFVEACLNKEPSFRPTAKELLKHKFILRNAKKTSYLTELIDRYKRWKAEQSHDDSSSEDSDAETDGQASGGSDSGDWIFTIREKDPKNLENGALQPSDLDRNKMKDIPKRPFSQCLSTIISPLFAELKEKSQACGGNLGSIEELRGAIYLAEEACPGISDTMVAQLVQRLQRYSLSGGGTSSH DIP protein Q9Y6E0 original sequence version: 130 DIP protein Q9Y6E0 original sequence version: 146 4A9FF1F6B6A88A97 pdc10_human Programmed cell death protein 10 PDCD10 CCM3 TFAR15 TF-1 cell apoptosis-related protein 15 Cerebral cavernous malformations 3 protein protein protein human Homo sapiens Human MRMTMEEMKNEAETTSMVSMPLYAVMYPVFNELERVNLSAAQTLRAAFIKAEKENPGLTQDIIMKILEKKSVEVNFTESLLRMAADDVEEYMIERPEPEFQDLNEKARALKQILSKIPDEINDRVRFLQTIKDIASAIKELLDTVNNVFKKYQYQNRRALEHQKKEFVKYSKSFSDTLKTYFKDGKAINVFVSANRLIHQTNLILQTFKTVA DIP protein Q9BUL8 original sequence version: 96 DIP protein Q9BUL8 original sequence version: 125 5AA613F71FAAEF56 q9p289-1 Serine/threonine-protein kinase 26 STK26 MASK MST4 MST3 and SOK1-related kinase Mammalian STE20-like protein kinase 4 Serine/threonine-protein kinase MASK protein protein human Homo sapiens Human MAHSPVAVQVPGMQNNIADPEELFTKLERIGKGSFGEVFKGIDNRTQQVVAIKIIDLEEAEDEIEDIQQEITVLSQCDSSYVTKYYGSYLKGSKLWIIMEYLGGGSALDLLRAGPFDEFQIATMLKEILKGLDYLHSEKKIHRDIKAANVLLSEQGDVKLADFGVAGQLTDTQIKRNTFVGTPFWMAPEVIQQSAYDSKADIWSLGITAIELAKGEPPNSDMHPMRVLFLIPKNNPPTLVGDFTKSFKEFIDACLNKDPSFRPTAKELLKHKFIVKNSKKTSYLTELIDRFKRWKAEGHSDDESDSEGSDSESTSRENNTHPEWSFTTVRKKPDPKKVQNGAEQDLVQTLSCLSMIITPAFAELKQQDENNASRNQAIEELEKSIAVAEAACPGITDKMVKKLIEKFQKCSADESP DIP protein Q9P289-1 original sequence version: 101 DIP protein Q9P289-1 original sequence version: 103 DIP protein Q9P289-1 original sequence version: 104 DIP protein Q9P289 original sequence version: 132 pdcd10-stk26-3 5 13 unspecified role unspecified role prey prey ecolx Escherichia coli 12 unspecified role unspecified role bait bait Q9BUL8:p.Met26Glu M26E mutation decreasing strength mutation decreasing interaction strength mutation decreasing strength substitut analysis substitution analysis substitut analysis certain certain sequence position certain certain certain sequence position certain M E This feature has been corrected as a result of our quality control procedures. The original label was 'M26E'. Wed May 02 15:25:43 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'met26glu' Tue Jun 30 19:48:06 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Met26Glu' Q9BUL8:p.Leu44Asp L44D mutation decreasing strength mutation decreasing interaction strength mutation decreasing strength substitut analysis substitution analysis substitut analysis certain certain sequence position certain certain certain sequence position certain L D This feature has been corrected as a result of our quality control procedures. The original label was 'L44D'. Wed May 02 18:02:04 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'leu44asp' Tue Jun 30 17:15:46 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Leu44Asp' Q9BUL8:p.Phe48Glu F48E mutation disrupting strength mutation disrupting interaction strength mutation disrupting strength substitut analysis substitution analysis substitut analysis certain certain sequence position certain certain certain sequence position certain F E This feature has been corrected as a result of our quality control procedures. The original label was 'F48E'. Wed May 02 15:20:21 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'phe48glu' Tue Jun 30 19:25:22 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Phe48Glu' Q9BUL8:p.Ile66Asp I66D mutation disrupting strength mutation disrupting interaction strength mutation disrupting strength substitut analysis substitution analysis substitut analysis certain certain sequence position certain certain certain sequence position certain I D This feature has been corrected as a result of our quality control procedures. The original label was 'I66D'. Wed May 02 19:11:03 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'ile66asp' Tue Jun 30 16:02:57 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Ile66Asp' Q9BUL8:p.[Met26Glu;Leu44Asp;Phe48Glu;Ile66Asp] M26E/L44D/F48E/I66D mutation disrupting strength mutation disrupting interaction strength mutation disrupting strength substitut analysis substitution analysis substitut analysis certain certain sequence position certain certain certain sequence position certain I D certain certain sequence position certain certain certain sequence position certain F E certain certain sequence position certain certain certain sequence position certain L D certain certain sequence position certain certain certain sequence position certain M E This feature has been corrected as a result of our quality control procedures. The original label was 'M26E/L44D/F48E/I66D'. Wed May 02 19:44:57 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'met26glu,leu44asp,phe48glu,ile66asp' Tue Jun 30 19:42:35 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.[Met26Glu;Leu44Asp;Phe48Glu;Ile66Asp]' ecolx Escherichia coli direct interaction direct interaction pdcd10-stk26-4 4 13 unspecified role unspecified role unspecified role unspecified role Region 325-413 Region 325-413 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain ecolx Escherichia coli 12 unspecified role unspecified role unspecified role unspecified role Region 9-212 Region 9-212 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain ecolx Escherichia coli direct interaction direct interaction stk26-pdcd10-5 8 13 unspecified role unspecified role bait bait Myc-tag Myc-tag myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range Q9P289-1:p.[Phe361Glu;Leu381Asp;Met399Glu;Leu403Asp] F361E/L381D/M399E/L403D mutation disrupting strength mutation disrupting interaction strength mutation disrupting strength substitut analysis substitution analysis substitut analysis certain certain sequence position certain certain certain sequence position certain L D certain certain sequence position certain certain certain sequence position certain M E certain certain sequence position certain certain certain sequence position certain L D certain certain sequence position certain certain certain sequence position certain F E This feature has been corrected as a result of our quality control procedures. The original label was 'F361E/L381D/M399E/L403D'. Wed May 02 15:06:57 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'phe361glu,leu381asp,met399glu,leu403asp' Tue Jun 30 18:36:50 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.[Phe361Glu;Leu381Asp;Met399Glu;Leu403Asp]' Q9P289-1:p.Phe361Glu F361E mutation disrupting strength mutation disrupting interaction strength mutation disrupting strength substitut analysis substitution analysis substitut analysis certain certain sequence position certain certain certain sequence position certain F E This feature has been corrected as a result of our quality control procedures. The original label was 'F361E'. Wed May 02 15:39:11 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'phe361glu' Tue Jun 30 16:32:12 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Phe361Glu' Q9P289-1:p.Leu381Asp L381D mutation disrupting strength mutation disrupting interaction strength mutation disrupting strength substitut analysis substitution analysis substitut analysis certain certain sequence position certain certain certain sequence position certain L D This feature has been corrected as a result of our quality control procedures. The original label was 'L381D'. Wed May 02 20:16:37 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'leu381asp' Tue Jun 30 19:44:41 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Leu381Asp' Q9P289-1:p.Met399Glu M399E mutation disrupting strength mutation disrupting interaction strength mutation disrupting strength substitut analysis substitution analysis substitut analysis certain certain sequence position certain certain certain sequence position certain M E This feature has been corrected as a result of our quality control procedures. The original label was 'M399E'. Wed May 02 15:44:22 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'met399glu' Tue Jun 30 17:31:11 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Met399Glu' Q9P289-1:p.Leu403Asp L403D mutation disrupting strength mutation disrupting interaction strength mutation disrupting strength substitut analysis substitution analysis substitut analysis certain certain sequence position certain certain certain sequence position certain L D This feature has been corrected as a result of our quality control procedures. The original label was 'L403D'. Wed May 02 15:41:36 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'leu403asp' Tue Jun 30 17:02:29 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Leu403Asp' Q9P289-1:p.Phe407Glu F407E mutation disrupting strength mutation disrupting interaction strength mutation disrupting strength substitut analysis substitution analysis substitut analysis certain certain sequence position certain certain certain sequence position certain F E This feature has been corrected as a result of our quality control procedures. The original label was 'F407E'. Wed May 02 19:29:26 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'phe407glu' Tue Jun 30 18:35:17 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Phe407Glu' human Homo sapiens Human 12 unspecified role unspecified role prey prey Flag-tag Flag-tag flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged n-term range n-terminal range n-term range n-term range n-terminal range n-term range human Homo sapiens Human physical association physical association pdcd10-stk24-8 6 11 unspecified role unspecified role prey prey ecolx Escherichia coli 12 unspecified role unspecified role bait bait ecolx Escherichia coli direct interaction direct interaction pdcd10-stk26-5 3 13 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli 12 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli direct interaction direct interaction stk24-pdcd10-2 9 11 unspecified role unspecified role bait bait His-tag His-tag his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range ecolx Escherichia coli 12 unspecified role unspecified role prey prey ecolx Escherichia coli direct interaction direct interaction stk26-pdcd10-6 2 13 unspecified role unspecified role bait bait Myc-tag Myc-tag myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range human Homo sapiens Human 12 unspecified role unspecified role prey prey Q9BUL8:p.Met26Glu M26E mutation disrupting strength mutation disrupting interaction strength mutation disrupting strength substitut analysis substitution analysis substitut analysis certain certain sequence position certain certain certain sequence position certain M E This feature has been corrected as a result of our quality control procedures. The original label was 'M26E'. Wed May 02 15:48:52 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'met26glu' Tue Jun 30 20:23:54 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Met26Glu' Q9BUL8:p.Leu44Asp L44D mutation disrupting strength mutation disrupting interaction strength mutation disrupting strength substitut analysis substitution analysis substitut analysis certain certain sequence position certain certain certain sequence position certain L D This feature has been corrected as a result of our quality control procedures. The original label was 'L44D'. Wed May 02 15:08:09 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'leu44asp' Tue Jun 30 15:57:46 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Leu44Asp' Q9BUL8:p.Phe48Glu F48E mutation disrupting strength mutation disrupting interaction strength mutation disrupting strength substitut analysis substitution analysis substitut analysis certain certain sequence position certain certain certain sequence position certain F E This feature has been corrected as a result of our quality control procedures. The original label was 'F48E'. Wed May 02 15:40:46 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'phe48glu' Tue Jun 30 17:47:03 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Phe48Glu' Q9BUL8:p.Ile66Asp I66D mutation disrupting strength mutation disrupting interaction strength mutation disrupting strength substitut analysis substitution analysis substitut analysis certain certain sequence position certain certain certain sequence position certain I D This feature has been corrected as a result of our quality control procedures. The original label was 'I66D'. Wed May 02 19:07:53 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'ile66asp' Tue Jun 30 16:38:23 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Ile66Asp' Q9BUL8:p.[Met26Glu;Leu44Asp;Phe48Glu;Ile66Asp] M26E/L44D/F48E/I66D mutation disrupting strength mutation disrupting interaction strength mutation disrupting strength substitut analysis substitution analysis substitut analysis certain certain sequence position certain certain certain sequence position certain I D certain certain sequence position certain certain certain sequence position certain F E certain certain sequence position certain certain certain sequence position certain L D certain certain sequence position certain certain certain sequence position certain M E This feature has been corrected as a result of our quality control procedures. The original label was 'M26E/L44D/F48E/I66D'. Wed May 02 18:29:45 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'met26glu,leu44asp,phe48glu,ile66asp' Tue Jun 30 17:25:57 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.[Met26Glu;Leu44Asp;Phe48Glu;Ile66Asp]' Flag-tag Flag-tag flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged n-term range n-terminal range n-term range n-term range n-terminal range n-term range human Homo sapiens Human physical association physical association stk26-pdcd10-7 10 13 unspecified role unspecified role bait bait His-tag His-tag his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range ecolx Escherichia coli 12 unspecified role unspecified role prey prey ecolx Escherichia coli direct interaction direct interaction pdcd10-stk26-6 7 13 unspecified role unspecified role unspecified role unspecified role Region 325-413 Region 325-413 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain ecolx Escherichia coli 12 unspecified role unspecified role unspecified role unspecified role Region 9-212 Region 9-212 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain ecolx Escherichia coli direct interaction direct interaction pdcd10-stk26-7 1 13 unspecified role unspecified role prey prey Q9P289-1:p.Met399Glu M399E mutation decreasing strength mutation decreasing interaction strength mutation decreasing strength substitut analysis substitution analysis substitut analysis certain certain sequence position certain certain certain sequence position certain M E This feature has been corrected as a result of our quality control procedures. The original label was 'M399E'. Wed May 02 19:37:28 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'met399glu' Tue Jun 30 16:30:57 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Met399Glu' Q9P289-1:p.Leu381Asp L381D mutation decreasing strength mutation decreasing interaction strength mutation decreasing strength substitut analysis substitution analysis substitut analysis certain certain sequence position certain certain certain sequence position certain L D This feature has been corrected as a result of our quality control procedures. The original label was 'L381D'. Wed May 02 16:05:07 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'leu381asp' Tue Jun 30 16:05:42 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Leu381Asp' Q9P289-1:p.[Phe361Glu;Leu381Asp;Met399Glu;Leu403Asp] F361E/L381D/M399E/L403D mutation disrupting strength mutation disrupting interaction strength mutation disrupting strength substitut analysis substitution analysis substitut analysis certain certain sequence position certain certain certain sequence position certain L D certain certain sequence position certain certain certain sequence position certain M E certain certain sequence position certain certain certain sequence position certain L D certain certain sequence position certain certain certain sequence position certain F E This feature has been corrected as a result of our quality control procedures. The original label was 'F361E/L381D/M399E/L403D'. Wed May 02 15:59:18 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'phe361glu,leu381asp,met399glu,leu403asp' Tue Jun 30 17:28:36 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.[Phe361Glu;Leu381Asp;Met399Glu;Leu403Asp]' ecolx Escherichia coli 12 unspecified role unspecified role bait bait ecolx Escherichia coli direct interaction direct interaction