DIP Database of Interacting Proteins 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ dip@mbi.ucla.edu Conformational change-induced repeat domain expansion regulates Rap phosphatase quorum-sensing signal receptors. Conformational change-induced repeat domain expansion regulates Rap phosphatase quorum-sensing signal receptors. PLoS biology 2012 imex curation Parashar V., Jeffrey PD., Neiditch MB. Only protein-protein interactions in vitro In vitro molecular sieving molecular sieving Gel Filtration Size Exclusion Chromatography Size Exclusion Chromatography Gel Filtration Sizing column predetermined predetermined participant predetermined Parashar V., Jeffrey PD., Neiditch MB. DIP original experiment: DIP-252411X PLoS biology 2012 IMEx Conformational change-induced repeat domain expansion regulates Rap phosphatase quorum-sensing signal receptors. Conformational change-induced repeat domain expansion regulates Rap phosphatase quorum-sensing signal receptors. Conformational change-induced repeat domain expansion regulates Rap phosphatase quorum-sensing signal receptors. PLoS biology 2012 imex curation Parashar V., Jeffrey PD., Neiditch MB. Only protein-protein interactions in vitro In vitro x-ray diffraction x-ray crystallography X-ray X-ray x-ray diffraction predetermined predetermined participant predetermined Parashar V., Jeffrey PD., Neiditch MB. DIP original experiment: DIP-252410X PLoS biology 2012 IMEx Conformational change-induced repeat domain expansion regulates Rap phosphatase quorum-sensing signal receptors. Conformational change-induced repeat domain expansion regulates Rap phosphatase quorum-sensing signal receptors. Conformational change-induced repeat domain expansion regulates Rap phosphatase quorum-sensing signal receptors. PLoS biology 2012 imex curation Parashar V., Jeffrey PD., Neiditch MB. Only protein-protein interactions in vitro In vitro phosphatase assay phosphatase assay predetermined predetermined participant predetermined Parashar V., Jeffrey PD., Neiditch MB. DIP original experiment: DIP-252415X PLoS biology 2012 IMEx Conformational change-induced repeat domain expansion regulates Rap phosphatase quorum-sensing signal receptors. Conformational change-induced repeat domain expansion regulates Rap phosphatase quorum-sensing signal receptors. Conformational change-induced repeat domain expansion regulates Rap phosphatase quorum-sensing signal receptors. PLoS biology 2012 imex curation Parashar V., Jeffrey PD., Neiditch MB. Only protein-protein interactions in vitro In vitro solution sedimentati cosedimentation in solution solution sedimentati predetermined predetermined participant predetermined Parashar V., Jeffrey PD., Neiditch MB. DIP original experiment: DIP-252412X PLoS biology 2012 IMEx Conformational change-induced repeat domain expansion regulates Rap phosphatase quorum-sensing signal receptors. Conformational change-induced repeat domain expansion regulates Rap phosphatase quorum-sensing signal receptors. Conformational change-induced repeat domain expansion regulates Rap phosphatase quorum-sensing signal receptors. PLoS biology 2012 imex curation Parashar V., Jeffrey PD., Neiditch MB. Only protein-protein interactions in vitro In vitro phosphatase assay phosphatase assay autoradiography autoradiography Parashar V., Jeffrey PD., Neiditch MB. DIP original experiment: DIP-252414X PLoS biology 2012 IMEx Conformational change-induced repeat domain expansion regulates Rap phosphatase quorum-sensing signal receptors. Conformational change-induced repeat domain expansion regulates Rap phosphatase quorum-sensing signal receptors. Conformational change-induced repeat domain expansion regulates Rap phosphatase quorum-sensing signal receptors. PLoS biology 2012 imex curation Parashar V., Jeffrey PD., Neiditch MB. Only protein-protein interactions in vitro In vitro ms of complexes mass spectrometry studies of complexes ms of complexes predetermined predetermined participant predetermined Parashar V., Jeffrey PD., Neiditch MB. DIP original experiment: DIP-252413X PLoS biology 2012 IMEx Conformational change-induced repeat domain expansion regulates Rap phosphatase quorum-sensing signal receptors. rapj_bacsu Response regulator aspartate phosphatase J ycdE BSU02820 rapJ protein protein bacsu Bacillus subtilis MRAKIPSEEVAVKLNEWYKLIRAFEADQAEALKQEIEYDLEDMEENQDLLLYFSLMEFRHRIMLDKLMPVKDSDTKPPFSDMLNEIESNQQKLTGLLEYYFYYFRGMYEFKQKNFILAIDHYKHAEEKLEYVEDEIEKAEFLFKVAEVYYHIKQTYFSMNYASQALDIYTKYELYGRRRVQCEFIIAGNLTDVYHHEKALTHLCSALEHARQLEEAYMIAAAYYNVGHCKYSLGDYKEAEGYFKTAAAIFEEHNFQQAVQAVFSLTHIYCKEGKYDKAVEAYDRGIKSAAEWEDDMYLTKFRLIHELYLGSGDLNVLTECFDLLESRQLLADAEDLLHDTAERFNQLEHYESAAFFYRRLMNIKKKLAEQRFQ E5EC939CE2B6E1DC E5EC939CE2B6E1DC rapi_bacsu Response regulator aspartate phosphatase I rapI yddL BSU05010 protein protein bacsu Bacillus subtilis MRGVFLDKDKIPYDLVTKKLNEWYTSIKNDQVEQAEIIKTEVEKELLNMEENQDALLYYQLLEFRHEIMLSYMKSKEIEDLNNAYETIKEIEKQGQLTGMLEYYFYFFKGMYEFRRKELISAISAYRIAESKLSEVEDEIEKAEFFFKVSYVYYYMKQTYFSMNYANRALKIFREYEEYAVQTVRCQFIVAGNLIDSLEYERALEQFLKSLEISKESNIEHLIAMSHMNIGICYDELKEYKKASQHLILALEIFEKSKHSFLTKTLFTLTYVEAKQQNYNVALIYFRKGRFIADKSDDKEYSAKFKILEGLFFSDGETQLIKNAFSYLASRKMFADVENFSIEVADYFHEQGNLMLSNEYYRMSIEARRKIKKGEIIDENQPDSIGSSDFK DIP protein P96649 original sequence version: 86 phrc_bacsu Phosphatase RapC inhibitor phrC hprC BSU03780 Phosphatase regulator C protein protein bacsu Bacillus subtilis MKLKSKLFVICLAAAAIFTAAGVSANAEALDFHVTERGMT DIP protein P94416 original sequence version: 61 sp0f_bacsu Sporulation initiation phosphotransferase F spo0F Stage 0 sporulation protein F BSU37130 protein protein bacsu Bacillus subtilis MMNEKILIVDDQYGIRILLNEVFNKEGYQTFQAANGLQALDIVTKERPDLVLLDMKIPGMDGIEILKRMKVIDENIRVIIMTAYGELDMIQESKELGALTHFAKPFDIDEIRDAVKKYLPLKSN 4130377E3558D698 4130377E3558D698 phrc-rapj-1 2 9 unspecified role unspecified role unspecified role unspecified role Region 36-40 Region 36-40 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain in vitro In vitro 7 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli direct interaction direct interaction rapi-spo0f-1 3 8 enzyme enzyme unspecified role unspecified role ecolx Escherichia coli 10 enzyme target enzyme target substrate substrate unspecified role unspecified role 32P-label 32P-label 32p radiolabel 32p radiolabel P32 32P 32P P32 undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined ecolx Escherichia coli dephosphorylation dephosphorylation reaction dephosphorylation phrc-rapj-2 6 9 unspecified role unspecified role unspecified role unspecified role Region 36-40 Region 36-40 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain in vitro In vitro 7 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli direct interaction direct interaction phrc-rapj-3 1 9 unspecified role unspecified role unspecified role unspecified role Region 36-40 Region 36-40 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain in vitro In vitro 7 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli direct interaction direct interaction rapj-spo0f-2 5 7 enzyme enzyme unspecified role unspecified role ecolx Escherichia coli 10 enzyme target enzyme target substrate substrate unspecified role unspecified role 32P-label 32P-label 32p radiolabel 32p radiolabel P32 32P 32P P32 undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined ecolx Escherichia coli dephosphorylation dephosphorylation reaction dephosphorylation phrc-rapj-4 4 9 unspecified role unspecified role unspecified role unspecified role Region 36-40 Region 36-40 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain in vitro In vitro 7 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli direct interaction direct interaction