DIP Database of Interacting Proteins 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ dip@mbi.ucla.edu SCF(FBXL3) ubiquitin ligase targets cryptochromes at their cofactor pocket. SCF(FBXL3) ubiquitin ligase targets cryptochromes at their cofactor pocket. Nature 2013 imex curation Xing W., Busino L., Hinds TR., Marionni ST., Saifee NH., Bush MF., Pagano M., Zheng N. Only protein-protein interactions trini Trichoplusia ni (Cabbage looper) Cabbage looper pull down pull down predetermined predetermined participant predetermined Xing W., Busino L., Hinds TR., Marionni ST., Saifee NH., Bush MF., Pagano M., Zheng N. DIP original experiment: DIP-252782X Nature 2013 IMEx SCF(FBXL3) ubiquitin ligase targets cryptochromes at their cofactor pocket. SCF(FBXL3) ubiquitin ligase targets cryptochromes at their cofactor pocket. SCF(FBXL3) ubiquitin ligase targets cryptochromes at their cofactor pocket. Nature 2013 imex curation Xing W., Busino L., Hinds TR., Marionni ST., Saifee NH., Bush MF., Pagano M., Zheng N. Only protein-protein interactions trini Trichoplusia ni (Cabbage looper) Cabbage looper ms of complexes mass spectrometry studies of complexes ms of complexes predetermined predetermined participant predetermined Xing W., Busino L., Hinds TR., Marionni ST., Saifee NH., Bush MF., Pagano M., Zheng N. DIP original experiment: DIP-252777X Nature 2013 IMEx SCF(FBXL3) ubiquitin ligase targets cryptochromes at their cofactor pocket. SCF(FBXL3) ubiquitin ligase targets cryptochromes at their cofactor pocket. SCF(FBXL3) ubiquitin ligase targets cryptochromes at their cofactor pocket. Nature 2013 imex curation Xing W., Busino L., Hinds TR., Marionni ST., Saifee NH., Bush MF., Pagano M., Zheng N. Only protein-protein interactions human Homo sapiens Human anti tag coip anti tag coimmunoprecipitation anti tag coip western blot western blot Immuno blot Immuno blot Xing W., Busino L., Hinds TR., Marionni ST., Saifee NH., Bush MF., Pagano M., Zheng N. DIP original experiment: DIP-252787X Nature 2013 IMEx SCF(FBXL3) ubiquitin ligase targets cryptochromes at their cofactor pocket. SCF(FBXL3) ubiquitin ligase targets cryptochromes at their cofactor pocket. SCF(FBXL3) ubiquitin ligase targets cryptochromes at their cofactor pocket. Nature 2013 imex curation Xing W., Busino L., Hinds TR., Marionni ST., Saifee NH., Bush MF., Pagano M., Zheng N. Only protein-protein interactions human Homo sapiens Human anti tag coip anti tag coimmunoprecipitation anti tag coip western blot western blot Immuno blot Immuno blot Xing W., Busino L., Hinds TR., Marionni ST., Saifee NH., Bush MF., Pagano M., Zheng N. DIP original experiment: DIP-252786X Nature 2013 IMEx SCF(FBXL3) ubiquitin ligase targets cryptochromes at their cofactor pocket. SCF(FBXL3) ubiquitin ligase targets cryptochromes at their cofactor pocket. SCF(FBXL3) ubiquitin ligase targets cryptochromes at their cofactor pocket. Nature 2013 imex curation Xing W., Busino L., Hinds TR., Marionni ST., Saifee NH., Bush MF., Pagano M., Zheng N. Only protein-protein interactions human Homo sapiens Human anti tag coip anti tag coimmunoprecipitation anti tag coip anti tag western anti tag western blot anti tag western Xing W., Busino L., Hinds TR., Marionni ST., Saifee NH., Bush MF., Pagano M., Zheng N. DIP original experiment: DIP-252778X Nature 2013 IMEx SCF(FBXL3) ubiquitin ligase targets cryptochromes at their cofactor pocket. SCF(FBXL3) ubiquitin ligase targets cryptochromes at their cofactor pocket. SCF(FBXL3) ubiquitin ligase targets cryptochromes at their cofactor pocket. Nature 2013 imex curation Xing W., Busino L., Hinds TR., Marionni ST., Saifee NH., Bush MF., Pagano M., Zheng N. Only protein-protein interactions mouse Mus musculus Mouse anti tag coip anti tag coimmunoprecipitation anti tag coip western blot western blot Immuno blot Immuno blot Xing W., Busino L., Hinds TR., Marionni ST., Saifee NH., Bush MF., Pagano M., Zheng N. DIP original experiment: DIP-252779X Nature 2013 IMEx SCF(FBXL3) ubiquitin ligase targets cryptochromes at their cofactor pocket. SCF(FBXL3) ubiquitin ligase targets cryptochromes at their cofactor pocket. SCF(FBXL3) ubiquitin ligase targets cryptochromes at their cofactor pocket. Nature 2013 imex curation Xing W., Busino L., Hinds TR., Marionni ST., Saifee NH., Bush MF., Pagano M., Zheng N. Only protein-protein interactions mouse Mus musculus Mouse anti tag coip anti tag coimmunoprecipitation anti tag coip western blot western blot Immuno blot Immuno blot Xing W., Busino L., Hinds TR., Marionni ST., Saifee NH., Bush MF., Pagano M., Zheng N. DIP original experiment: DIP-252780X Nature 2013 IMEx SCF(FBXL3) ubiquitin ligase targets cryptochromes at their cofactor pocket. SCF(FBXL3) ubiquitin ligase targets cryptochromes at their cofactor pocket. SCF(FBXL3) ubiquitin ligase targets cryptochromes at their cofactor pocket. Nature 2013 imex curation Xing W., Busino L., Hinds TR., Marionni ST., Saifee NH., Bush MF., Pagano M., Zheng N. Only protein-protein interactions human Homo sapiens Human anti tag coip anti tag coimmunoprecipitation anti tag coip western blot western blot Immuno blot Immuno blot Xing W., Busino L., Hinds TR., Marionni ST., Saifee NH., Bush MF., Pagano M., Zheng N. DIP original experiment: DIP-252785X Nature 2013 IMEx SCF(FBXL3) ubiquitin ligase targets cryptochromes at their cofactor pocket. SCF(FBXL3) ubiquitin ligase targets cryptochromes at their cofactor pocket. SCF(FBXL3) ubiquitin ligase targets cryptochromes at their cofactor pocket. Nature 2013 imex curation Xing W., Busino L., Hinds TR., Marionni ST., Saifee NH., Bush MF., Pagano M., Zheng N. Only protein-protein interactions human Homo sapiens Human anti tag coip anti tag coimmunoprecipitation anti tag coip western blot western blot Immuno blot Immuno blot Xing W., Busino L., Hinds TR., Marionni ST., Saifee NH., Bush MF., Pagano M., Zheng N. DIP original experiment: DIP-252783X Nature 2013 IMEx SCF(FBXL3) ubiquitin ligase targets cryptochromes at their cofactor pocket. SCF(FBXL3) ubiquitin ligase targets cryptochromes at their cofactor pocket. SCF(FBXL3) ubiquitin ligase targets cryptochromes at their cofactor pocket. Nature 2013 imex curation Xing W., Busino L., Hinds TR., Marionni ST., Saifee NH., Bush MF., Pagano M., Zheng N. Only protein-protein interactions trini Trichoplusia ni (Cabbage looper) Cabbage looper ion exchange chrom ion exchange chromatography IEC IEC ion exchange chrom predetermined predetermined participant predetermined Xing W., Busino L., Hinds TR., Marionni ST., Saifee NH., Bush MF., Pagano M., Zheng N. DIP original experiment: DIP-252774X Nature 2013 IMEx SCF(FBXL3) ubiquitin ligase targets cryptochromes at their cofactor pocket. SCF(FBXL3) ubiquitin ligase targets cryptochromes at their cofactor pocket. SCF(FBXL3) ubiquitin ligase targets cryptochromes at their cofactor pocket. Nature 2013 imex curation Xing W., Busino L., Hinds TR., Marionni ST., Saifee NH., Bush MF., Pagano M., Zheng N. Only protein-protein interactions human Homo sapiens Human anti tag coip anti tag coimmunoprecipitation anti tag coip western blot western blot Immuno blot Immuno blot Xing W., Busino L., Hinds TR., Marionni ST., Saifee NH., Bush MF., Pagano M., Zheng N. DIP original experiment: DIP-252784X Nature 2013 IMEx SCF(FBXL3) ubiquitin ligase targets cryptochromes at their cofactor pocket. SCF(FBXL3) ubiquitin ligase targets cryptochromes at their cofactor pocket. SCF(FBXL3) ubiquitin ligase targets cryptochromes at their cofactor pocket. Nature 2013 imex curation Xing W., Busino L., Hinds TR., Marionni ST., Saifee NH., Bush MF., Pagano M., Zheng N. Only protein-protein interactions trini Trichoplusia ni (Cabbage looper) Cabbage looper ms of complexes mass spectrometry studies of complexes ms of complexes predetermined predetermined participant predetermined Xing W., Busino L., Hinds TR., Marionni ST., Saifee NH., Bush MF., Pagano M., Zheng N. DIP original experiment: DIP-252776X Nature 2013 IMEx SCF(FBXL3) ubiquitin ligase targets cryptochromes at their cofactor pocket. SCF(FBXL3) ubiquitin ligase targets cryptochromes at their cofactor pocket. SCF(FBXL3) ubiquitin ligase targets cryptochromes at their cofactor pocket. Nature 2013 imex curation Xing W., Busino L., Hinds TR., Marionni ST., Saifee NH., Bush MF., Pagano M., Zheng N. Only protein-protein interactions trini Trichoplusia ni (Cabbage looper) Cabbage looper x-ray diffraction x-ray crystallography X-ray X-ray x-ray diffraction predetermined predetermined participant predetermined Xing W., Busino L., Hinds TR., Marionni ST., Saifee NH., Bush MF., Pagano M., Zheng N. DIP original experiment: DIP-252772X Nature 2013 IMEx SCF(FBXL3) ubiquitin ligase targets cryptochromes at their cofactor pocket. SCF(FBXL3) ubiquitin ligase targets cryptochromes at their cofactor pocket. SCF(FBXL3) ubiquitin ligase targets cryptochromes at their cofactor pocket. Nature 2013 imex curation Xing W., Busino L., Hinds TR., Marionni ST., Saifee NH., Bush MF., Pagano M., Zheng N. Only protein-protein interactions trini Trichoplusia ni (Cabbage looper) Cabbage looper molecular sieving molecular sieving Gel Filtration Size Exclusion Chromatography Size Exclusion Chromatography Gel Filtration Sizing column predetermined predetermined participant predetermined Xing W., Busino L., Hinds TR., Marionni ST., Saifee NH., Bush MF., Pagano M., Zheng N. DIP original experiment: DIP-252775X Nature 2013 IMEx SCF(FBXL3) ubiquitin ligase targets cryptochromes at their cofactor pocket. SCF(FBXL3) ubiquitin ligase targets cryptochromes at their cofactor pocket. SCF(FBXL3) ubiquitin ligase targets cryptochromes at their cofactor pocket. Nature 2013 imex curation Xing W., Busino L., Hinds TR., Marionni ST., Saifee NH., Bush MF., Pagano M., Zheng N. Only protein-protein interactions trini Trichoplusia ni (Cabbage looper) Cabbage looper pull down pull down predetermined predetermined participant predetermined Xing W., Busino L., Hinds TR., Marionni ST., Saifee NH., Bush MF., Pagano M., Zheng N. DIP original experiment: DIP-252773X Nature 2013 IMEx SCF(FBXL3) ubiquitin ligase targets cryptochromes at their cofactor pocket. cry2_mouse Cryptochrome-2 Cry2 Kiaa0658 protein protein mouse Mus musculus Mouse MAAAAVVAATVPAQSMGADGASSVHWFRKGLRLHDNPALLAAVRGARCVRCVYILDPWFAASSSVGINRWRFLLQSLEDLDTSLRKLNSRLFVVRGQPADVFPRLFKEWGVTRLTFEYDSEPFGKERDAAIMKMAKEAGVEVVTENSHTLYDLDRIIELNGQKPPLTYKRFQALISRMELPKKPAVAVSSQQMESCRAEIQENHDDTYGVPSLEELGFPTEGLGPAVWQGGETEALARLDKHLERKAWVANYERPRMNANSLLASPTGLSPYLRFGCLSCRLFYYRLWDLYKKVKRNSTPPLSLFGQLLWREFFYTAATNNPRFDRMEGNPICIQIPWDRNPEALAKWAEGKTGFPWIDAIMTQLRQEGWIHHLARHAVACFLTRGDLWVSWESGVRVFDELLLDADFSVNAGSWMWLSCSAFFQQFFHCYCPVGFGRRTDPSGDYIRRYLPKLKGFPSRYIYEPWNAPESVQKAAKCIIGVDYPRPIVNHAETSRLNIERMKQIYQQLSRYRGLCLLASVPSCVEDLSHPVAEPGSSQAGSISNTGPRALSSGPASPKRKLEAAEEPPGEELTKRARVTEMPTQEPASKDS DIP protein Q9R194 original sequence version: 77 DIP protein Q9R194 original sequence version: 94 DIP protein Q9R194 original sequence version: 105 DIP protein Q9R194 original sequence version: 121 DIP protein Q9R194 original sequence version: 87 4D6E7B199C392CBB skp1_mouse S-phase kinase-associated protein 1 Skp1 Skp1a S-phase kinase-associated protein 1A Cyclin-A/CDK2-associated protein p19 p19skp1 p19A protein protein mouse Mus musculus Mouse MPTIKLQSSDGEIFEVDVEIAKQSVTIKTMLEDLGMDDEGDDDPVPLPNVNAAILKKVIQWCTHHKDDPPPPEDDENKEKRTDDIPVWDQEFLKVDQGTLFELILAANYLDIKGLLDVTCKTVANMIKGKTPEEIRKTFNIKNDFTEEEEAQVRKENQWCEEK DIP protein Q9WTX5 original sequence version: 100 DIP protein Q9WTX5 original sequence version: 108 AE184C00BE6556DB fbxl3_human F-box/LRR-repeat protein 3 FBL3A FBXL3A F-box and leucine-rich repeat protein 3A F-box/LRR-repeat protein 3A FBXL3 protein protein human Homo sapiens Human MKRGGRDSDRNSSEEGTAEKSKKLRTTNEHSQTCDWGNLLQDIILQVFKYLPLLDRAHASQVCRNWNQVFHMPDLWRCFEFELNQPATSYLKATHPELIKQIIKRHSNHLQYVSFKVDSSKESAEAACDILSQLVNCSLKTLGLISTARPSFMDLPKSHFISALTVVFVNSKSLSSLKIDDTPVDDPSLKVLVANNSDTLKLLKMSSCPHVSPAGILCVADQCHGLRELALNYHLLSDELLLALSSEKHVRLEHLRIDVVSENPGQTHFHTIQKSSWDAFIRHSPKVNLVMYFFLYEEEFDPFFRYEIPATHLYFGRSVSKDVLGRVGMTCPRLVELVVCANGLRPLDEELIRIAERCKNLSAIGLGECEVSCSAFVEFVKMCGGRLSQLSIMEEVLIPDQKYSLEQIHWEVSKHLGRVWFPDMMPTW DIP protein Q9UKT7 original sequence version: 94 AAEAB31BAF0EA5A5 p63208-1 S-phase kinase-associated protein 1 SKP1 EMC19 OCP2 SKP1A TCEB1L Cyclin-A/CDK2-associated protein p19 Organ of Corti protein 2 Organ of Corti protein II RNA polymerase II elongation factor-like protein SIII p19skp1 Transcription elongation factor B polypeptide 1-like protein protein human Homo sapiens Human MPSIKLQSSDGEIFEVDVEIAKQSVTIKTMLEDLGMDDEGDDDPVPLPNVNAAILKKVIQWCTHHKDDPPPPEDDENKEKRTDDIPVWDQEFLKVDQGTLFELILAANYLDIKGLLDVTCKTVANMIKGKTPEEIRKTFNIKNDFTEEEEAQVRKENQWCEEK DIP protein P63208-1 original sequence version: 128 DIP protein P63208-1 original sequence version: 116 DIP protein P63208 original sequence version: 76 DIP protein P63208-1 original sequence version: 76 DIP protein P63208 original sequence version: 104 DIP protein P63208 original sequence version: 127 DIP protein P63208 original sequence version: 123 DIP protein P63208 original sequence version: 61 DIP protein P63208 original sequence version: 91 DIP protein P63208 original sequence version: 115 DIP protein P63208 original sequence version: 94 DIP protein P63208 original sequence version: 75 DIP protein P63208 original sequence version: 85 C794D62AFB75528A bmal1_human Aryl hydrocarbon receptor nuclear translocator-like protein 1 ARNTL BMAL1 MOP3 Brain and muscle ARNT-like 1 Member of PAS protein 3 Basic-helix-loop-helix-PAS protein MOP3 bHLH-PAS protein JAP3 BHLHE5 PASD3 PAS domain-containing protein 3 Class E basic helix-loop-helix protein 5 protein protein human Homo sapiens Human MADQRMDISSTISDFMSPGPTDLLSSSLGTSGVDCNRKRKGSSTDYQESMDTDKDDPHGRLEYTEHQGRIKNAREAHSQIEKRRRDKMNSFIDELASLVPTCNAMSRKLDKLTVLRMAVQHMKTLRGATNPYTEANYKPTFLSDDELKHLILRAADGFLFVVGCDRGKILFVSESVFKILNYSQNDLIGQSLFDYLHPKDIAKVKEQLSSSDTAPRERLIDAKTGLPVKTDITPGPSRLCSGARRSFFCRMKCNRPSVKVEDKDFPSTCSKKKADRKSFCTIHSTGYLKSWPPTKMGLDEDNEPDNEGCNLSCLVAIGRLHSHVVPQPVNGEIRVKSMEYVSRHAIDGKFVFVDQRATAILAYLPQELLGTSCYEYFHQDDIGHLAECHRQVLQTREKITTNCYKFKIKDGSFITLRSRWFSFMNPWTKEVEYIVSTNTVVLANVLEGGDPTFPQLTASPHSMDSMLPSGEGGPKRTHPTVPGIPGGTRAGAGKIGRMIAEEIMEIHRIRGSSPSSCGSSPLNITSTPPPDASSPGGKKILNGGTPDIPSSGLLSGQAQENPGYPYSDSSSILGENPHIGIDMIDNDQGSSSPSNDEAAMAVIMSLLEADAGLGGPVDFSDLPWPL DIP protein O00327 original sequence version: 137 DIP protein O00327 original sequence version: 148 820F0E07DC6265A6 per2_mouse Period circadian protein homolog 2 Per2 Circadian clock protein PERIOD 2 protein protein mouse Mus musculus Mouse MNGYVDFSPSPTSPTKEPGAPQPTQAVLQEDVDMSSGSSGNENCSTGRDSQGSDCDDNGKELRMLVESSNTHPSPDDAFRLMMTEAEHNPSTSGCSSEQSAKADAHKELIRTLKELKVHLPADKKAKGKASTLATLKYALRSVKQVKANEEYYQLLMSSESQPCSVDVPSYSMEQVEGITSEYIVKNADMFAVAVSLVSGKILYISNQVASIFHCKKDAFSDAKFVEFLAPHDVSVFHSYTTPYKLPPWSVCSGLDSFTQECMEEKSFFCRVSVGKHHENEIRYQPFRMTPYLVKVQEQQGAESQLCCLLLAERVHSGYEAPRIPPEKRIFTTTHTPNCLFQAVDERAVPLLGYLPQDLIETPVLVQLHPSDRPLMLAIHKKILQAGGQPFDYSPIRFRTRNGEYITLDTSWSSFINPWSRKISFIIGRHKVRVGPLNEDVFAAPPCPEEKTPHPSVQELTEQIHRLLMQPVPHSGSSGYGSLGSNGSHEHLMSQTSSSDSNGQEESHRRRSGIFKTSGKIQTKSHVSHESGGQKEASVAEMQSSPPAQVKAVTTIERDSSGASLPKASFPEELAYKNQPPCSYQQISCLDSVIRYLESCSEAATLKRKCEFPANIPSRKATVSPGLHSGEAARPSKVTSHTEVSAHLSSLTLPGKAESVVSLTSQCSYSSTIVHVGDKKPQPELETVEDMASGPESLDGAAGGLSQEKGPLQKLGLTKEVLAAHTQKEEQGFLQRFREVSRLSALQAHCQNYLQERSRAQASDRGLRNTSGLESSWKKTGKNRKLKSKRVKTRDSSESTGSGGPVSHRPPLMGLNATAWSPSDTSQSSCPSAPFPTAVPAYPLPVFQAPGIVSTPGTVVAPPAATHTGFTMPVVPMGTQPEFAVQPLPFAAPLAPVMAFMLPSYPFPPATPNLPQAFLPSQPHFPAHPTLASEITPASQAEFPSRTSTLRQPCACPVTPPAGTVALGRASPPLFQSRGSSPLQLNLLQLEEAPEGSTGAAGTLGTTGTAASGLDCTSGTSRDRQPKAPPTCNEPSDTQNSDAISTSSDLLNLLLGEDLCSATGSALSRSGASATSDSLGSSSLGFGTSQSGAGSSDTSHTSKYFGSIDSSENNHKAKMIPDTEESEQFIKYVLQDPIWLLMANTDDSIMMTYQLPSRDLQAVLKEDQEKLKLLQRSQPRFTEGQRRELREVHPWVHTGGLPTAIDVTGCVYCESEEKGNICLPYEEDSPSPGLCDTSEAKEEEGEQLTGPRIEAQT DIP protein O54943 original sequence version: 120 DIP protein O54943 original sequence version: 83 DIP protein O54943 original sequence version: 87 DIP protein O54943 original sequence version: 104 DIP protein O54943 original sequence version: 111 DIP protein O54943 original sequence version: 114 DIP protein O54943 original sequence version: 98 554B8AFF036CF7FB per1_human Period circadian protein homolog 1 KIAA0482 PER RIGUI Circadian clock protein PERIOD 1 Circadian pacemaker protein Rigui PER1 protein protein human Homo sapiens Human MSGPLEGADGGGDPRPGESFCPGGVPSPGPPQHRPCPGPSLADDTDANSNGSSGNESNGHESRGASQRSSHSSSSGNGKDSALLETTESSKSTNSQSPSPPSSSIAYSLLSASSEQDNPSTSGCSSEQSARARTQKELMTALRELKLRLPPERRGKGRSGTLATLQYALACVKQVQANQEYYQQWSLEEGEPCSMDMSTYTLEELEHITSEYTLQNQDTFSVAVSFLTGRIVYISEQAAVLLRCKRDVFRGTRFSELLAPQDVGVFYGSTAPSRLPTWGTGASAGSGLRDFTQEKSVFCRIRGGPDRDPGPRYQPFRLTPYVTKIRVSDGAPAQPCCLLIAERIHSGYEAPRIPPDKRIFTTRHTPSCLFQDVDERAAPLLGYLPQDLLGAPVLLFLHPEDRPLMLAIHKKILQLAGQPFDHSPIRFCARNGEYVTMDTSWAGFVHPWSRKVAFVLGRHKVRTAPLNEDVFTPPAPSPAPSLDTDIQELSEQIHRLLLQPVHSPSPTGLCGVGAVTSPGPLHSPGSSSDSNGGDAEGPGPPAPVTFQQICKDVHLVKHQGQQLFIESRARPQSRPRLPATGTFKAKALPCQSPDPELEAGSAPVQAPLALVPEEAERKEASSCSYQQINCLDSILRYLESCNLPSTTKRKCASSSSYTTSSASDDDRQRTGPVSVGTKKDPPSAALSGEGATPRKEPVVGGTLSPLALANKAESVVSVTSQCSFSSTIVHVGDKKPPESDIIMMEDLPGLAPGPAPSPAPSPTVAPDPAPDAYRPVGLTKAVLSLHTQKEEQAFLSRFRDLGRLRGLDSSSTAPSALGERGCHHGPAPPSRRHHCRSKAKRSRHHQNPRAEAPCYVSHPSPVPPSTPWPTPPATTPFPAVVQPYPLPVFSPRGGPQPLPPAPTSVPPAAFPAPLVTPMVALVLPNYLFPTPSSYPYGALQTPAEGPPTPASHSPSPSLPALAPSPPHRPDSPLFNSRCSSPLQLNLLQLEELPRAEGAAVAGGPGSSAGPPPPSAEAAEPEARLAEVTESSNQDALSGSSDLLELLLQEDSRSGTGSAASGSLGSGLGSGSGSGSHEGGSTSASITRSSQSSHTSKYFGSIDSSEAEAGAARGGAEPGDQVIKYVLQDPIWLLMANADQRVMMTYQVPSRDMTSVLKQDRERLRAMQKQQPRFSEDQRRELGAVHSWVRKGQLPRALDVMACVDCGSSTQDPGHPDDPLFSELDGLGLEPMEEGGGEQGSSGGGSGEGEGCEEAQGGAKASSSQDLAMEEEEEGRSSSSPALPTAGNCTS DIP protein O15534 original sequence version: 141 DIP protein O15534 original sequence version: 125 60B844468EEF4D1B cry2-fbxl3-1 4 19 unspecified role unspecified role prey prey human Homo sapiens Human 18 unspecified role unspecified role prey prey human Homo sapiens Human 16 unspecified role unspecified role bait bait Flag-tag Flag-tag flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged n-term range n-terminal range n-term range n-term range n-terminal range n-term range Q9R194:p.Phe428Asp F428D mutation disrupting strength mutation disrupting interaction strength mutation disrupting strength substitut analysis substitution analysis substitut analysis certain certain sequence position certain certain certain sequence position certain F D This feature has been corrected as a result of our quality control procedures. The original label was 'F428D'. Wed May 02 18:20:39 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'phe428asp' Tue Jun 30 17:28:00 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Phe428Asp' Q9R194:p.Ile499Asp I499D mutation disrupting strength mutation disrupting interaction strength mutation disrupting strength substitut analysis substitution analysis substitut analysis certain certain sequence position certain certain certain sequence position certain I D This feature has been corrected as a result of our quality control procedures. The original label was 'I499D'. Wed May 02 17:17:58 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'ile499asp' Tue Jun 30 18:55:21 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Ile499Asp' human Homo sapiens Human association association cry2-fbxl3-2 13 19 unspecified role unspecified role unspecified role unspecified role trini Trichoplusia ni (Cabbage looper) Cabbage looper 18 unspecified role unspecified role unspecified role unspecified role trini Trichoplusia ni (Cabbage looper) Cabbage looper 16 unspecified role unspecified role unspecified role unspecified role Region 1-544 Region 1-544 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain trini Trichoplusia ni (Cabbage looper) Cabbage looper physical association physical association cry2-arntl-1 9 20 unspecified role unspecified role prey prey human Homo sapiens Human 22 unspecified role unspecified role prey prey human Homo sapiens Human 19 unspecified role unspecified role prey prey human Homo sapiens Human 18 unspecified role unspecified role prey prey human Homo sapiens Human 16 unspecified role unspecified role bait bait Flag-tag Flag-tag flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged n-term range n-terminal range n-term range n-term range n-terminal range n-term range Q9R194:p.Arg376Ala R376A mutation disrupting strength mutation disrupting interaction strength mutation disrupting strength alanine scanning alanine scanning certain certain sequence position certain certain certain sequence position certain R A This feature has been corrected as a result of our quality control procedures. The original label was 'R376A'. Wed May 02 19:29:28 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'arg376ala' Tue Jun 30 17:24:44 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Arg376Ala' human Homo sapiens Human association association fbxl3-cry2-5 7 16 unspecified role unspecified role prey prey mouse Mus musculus Mouse 18 unspecified role unspecified role bait bait Flag-tag Flag-tag flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged n-term range n-terminal range n-term range n-term range n-terminal range n-term range Q9UKT7:p.Glu336Ala E336A mutation disrupting strength mutation disrupting interaction strength mutation disrupting strength alanine scanning alanine scanning certain certain sequence position certain certain certain sequence position certain E A This feature has been corrected as a result of our quality control procedures. The original label was 'E336A'. Wed May 02 15:13:14 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'glu336ala' Tue Jun 30 20:24:07 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Glu336Ala' Q9UKT7:p.Tyr314Ala Y314A mutation disrupting strength mutation disrupting interaction strength mutation disrupting strength alanine scanning alanine scanning certain certain sequence position certain certain certain sequence position certain Y A This feature has been corrected as a result of our quality control procedures. The original label was 'Y314A'. Wed May 02 18:09:07 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'tyr314ala' Tue Jun 30 16:59:50 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Tyr314Ala' Region 424-428 Region 424-428 required to bind necessary binding region required to bind deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain Q9UKT7:p.Pro426Ala P426A mutation disrupting strength mutation disrupting interaction strength mutation disrupting strength alanine scanning alanine scanning certain certain sequence position certain certain certain sequence position certain P A This feature has been corrected as a result of our quality control procedures. The original label was 'P426A'. Wed May 02 19:00:20 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'pro426ala' Tue Jun 30 17:08:42 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Pro426Ala' Q9UKT7:p.Trp428Ala W428A mutation decreasing strength mutation decreasing interaction strength mutation decreasing strength alanine scanning alanine scanning certain certain sequence position certain certain certain sequence position certain W A This feature has been corrected as a result of our quality control procedures. The original label was 'W428A'. Wed May 02 17:44:45 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'trp428ala' Tue Jun 30 16:49:47 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Trp428Ala' Q9UKT7:p.Tyr292Ala Y292A mutation decreasing strength mutation decreasing interaction strength mutation decreasing strength alanine scanning alanine scanning certain certain sequence position certain certain certain sequence position certain Y A This feature has been corrected as a result of our quality control procedures. The original label was 'Y292A'. Wed May 02 18:26:54 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'tyr292ala' Tue Jun 30 17:05:25 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Tyr292Ala' mouse Mus musculus Mouse physical association physical association Fig. 6A cry2-fbxl3-3 12 19 unspecified role unspecified role unspecified role unspecified role trini Trichoplusia ni (Cabbage looper) Cabbage looper 18 unspecified role unspecified role unspecified role unspecified role trini Trichoplusia ni (Cabbage looper) Cabbage looper 16 unspecified role unspecified role unspecified role unspecified role Region 1-544 Region 1-544 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain trini Trichoplusia ni (Cabbage looper) Cabbage looper physical association physical association cry2-per1-1 8 22 unspecified role unspecified role prey prey human Homo sapiens Human 16 unspecified role unspecified role bait bait Flag-tag Flag-tag flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged n-term range n-terminal range n-term range n-term range n-terminal range n-term range Q9R194:p.Asp339Arg D339R mutation disrupting strength mutation disrupting interaction strength mutation disrupting strength substitut analysis substitution analysis substitut analysis certain certain sequence position certain certain certain sequence position certain D R This feature has been corrected as a result of our quality control procedures. The original label was 'D339R'. Wed May 02 15:31:34 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'asp339arg' Tue Jun 30 17:28:20 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Asp339Arg' human Homo sapiens Human physical association physical association fbxl3-cry2-6 15 19 unspecified role unspecified role prey prey trini Trichoplusia ni (Cabbage looper) Cabbage looper 18 unspecified role unspecified role bait bait GST-tag GST-tag gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range trini Trichoplusia ni (Cabbage looper) Cabbage looper 16 unspecified role unspecified role prey prey Region 1-544 Region 1-544 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain trini Trichoplusia ni (Cabbage looper) Cabbage looper association association cry2-fbxl3-4 2 18 unspecified role unspecified role unspecified role unspecified role trini Trichoplusia ni (Cabbage looper) Cabbage looper 16 unspecified role unspecified role unspecified role unspecified role Region 1-544 Region 1-544 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain trini Trichoplusia ni (Cabbage looper) Cabbage looper direct interaction direct interaction cry2-arntl-2 11 20 unspecified role unspecified role prey prey human Homo sapiens Human 19 unspecified role unspecified role prey prey human Homo sapiens Human 18 unspecified role unspecified role prey prey human Homo sapiens Human 16 unspecified role unspecified role bait bait Flag-tag Flag-tag flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged n-term range n-terminal range n-term range n-term range n-terminal range n-term range Q9R194:p.Asp339Arg D339R mutation mutation certain certain sequence position certain certain certain sequence position certain D R This feature has been corrected as a result of our quality control procedures. The original label was 'D339R'. Wed May 02 19:49:41 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'asp339arg' Tue Jun 30 20:20:21 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Asp339Arg' human Homo sapiens Human association association cry2-fbxl3-5 10 19 unspecified role unspecified role unspecified role unspecified role trini Trichoplusia ni (Cabbage looper) Cabbage looper 18 unspecified role unspecified role unspecified role unspecified role trini Trichoplusia ni (Cabbage looper) Cabbage looper 16 unspecified role unspecified role unspecified role unspecified role Region 1-544 Region 1-544 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain trini Trichoplusia ni (Cabbage looper) Cabbage looper association association per2-cry2-2 5 16 unspecified role unspecified role prey prey Flag-tag Flag-tag flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged n-term range n-terminal range n-term range n-term range n-terminal range n-term range human Homo sapiens Human 21 unspecified role unspecified role bait bait Myc-tag Myc-tag myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range human Homo sapiens Human physical association physical association fbxl3-cry2-7 1 18 unspecified role unspecified role bait bait Strep-tag Strep-tag strep tag strep tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range trini Trichoplusia ni (Cabbage looper) Cabbage looper 16 unspecified role unspecified role prey prey GST-tag GST-tag gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range trini Trichoplusia ni (Cabbage looper) Cabbage looper physical association physical association cry2-fbxl3-6 14 19 unspecified role unspecified role unspecified role unspecified role trini Trichoplusia ni (Cabbage looper) Cabbage looper 18 unspecified role unspecified role unspecified role unspecified role trini Trichoplusia ni (Cabbage looper) Cabbage looper 16 unspecified role unspecified role unspecified role unspecified role Region 1-544 Region 1-544 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain trini Trichoplusia ni (Cabbage looper) Cabbage looper physical association physical association cry2-arntl-3 3 20 unspecified role unspecified role prey prey human Homo sapiens Human 22 unspecified role unspecified role prey prey human Homo sapiens Human 16 unspecified role unspecified role bait bait Flag-tag Flag-tag flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged n-term range n-terminal range n-term range n-term range n-terminal range n-term range Q9R194:p.Phe428Asp F428D mutation mutation certain certain sequence position certain certain certain sequence position certain F D This feature has been corrected as a result of our quality control procedures. The original label was 'F428D'. Wed May 02 16:14:37 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'phe428asp' Tue Jun 30 19:56:24 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Phe428Asp' Q9R194:p.Ile499Asp I499D mutation mutation certain certain sequence position certain certain certain sequence position certain I D This feature has been corrected as a result of our quality control procedures. The original label was 'I499D'. Wed May 02 17:31:01 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'ile499asp' Tue Jun 30 18:47:55 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Ile499Asp' human Homo sapiens Human association association fbxl3-cry2-8 6 17 unspecified role unspecified role prey prey mouse Mus musculus Mouse 16 unspecified role unspecified role prey prey mouse Mus musculus Mouse 18 unspecified role unspecified role bait bait Flag-tag Flag-tag flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged n-term range n-terminal range n-term range n-term range n-terminal range n-term range mouse Mus musculus Mouse association association