DIP Database of Interacting Proteins 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ dip@mbi.ucla.edu The three-dimensional structure of the biotin carboxylase-biotin carboxyl carrier protein complex of E. coli acetyl-CoA carboxylase. The three-dimensional structure of the biotin carboxylase-biotin carboxyl carrier protein complex of E. coli acetyl-CoA carboxylase. Structure (London, England : 1993) 2013 imex curation Broussard TC., Kobe MJ., Pakhomova S., Neau DB., Price AE., Champion TS., Waldrop GL. Only protein-protein interactions ecolx Escherichia coli x-ray diffraction x-ray crystallography X-ray X-ray x-ray diffraction predetermined predetermined participant predetermined Broussard TC., Kobe MJ., Pakhomova S., Neau DB., Price AE., Champion TS., Waldrop GL. DIP original experiment: DIP-252209X Structure (London, England : 1993) 2013 IMEx The three-dimensional structure of the biotin carboxylase-biotin carboxyl carrier protein complex of E. coli acetyl-CoA carboxylase. The three-dimensional structure of the biotin carboxylase-biotin carboxyl carrier protein complex of E. coli acetyl-CoA carboxylase. The three-dimensional structure of the biotin carboxylase-biotin carboxyl carrier protein complex of E. coli acetyl-CoA carboxylase. Structure (London, England : 1993) 2013 imex curation Broussard TC., Kobe MJ., Pakhomova S., Neau DB., Price AE., Champion TS., Waldrop GL. Only protein-protein interactions ecolx Escherichia coli pull down pull down predetermined predetermined participant predetermined Broussard TC., Kobe MJ., Pakhomova S., Neau DB., Price AE., Champion TS., Waldrop GL. DIP original experiment: DIP-252207X Structure (London, England : 1993) 2013 IMEx The three-dimensional structure of the biotin carboxylase-biotin carboxyl carrier protein complex of E. coli acetyl-CoA carboxylase. The three-dimensional structure of the biotin carboxylase-biotin carboxyl carrier protein complex of E. coli acetyl-CoA carboxylase. The three-dimensional structure of the biotin carboxylase-biotin carboxyl carrier protein complex of E. coli acetyl-CoA carboxylase. Structure (London, England : 1993) 2013 imex curation Broussard TC., Kobe MJ., Pakhomova S., Neau DB., Price AE., Champion TS., Waldrop GL. Only protein-protein interactions ecolx Escherichia coli molecular sieving molecular sieving Gel Filtration Size Exclusion Chromatography Size Exclusion Chromatography Gel Filtration Sizing column weight by comassie molecular weight estimation by coomasie staining weight by comassie Broussard TC., Kobe MJ., Pakhomova S., Neau DB., Price AE., Champion TS., Waldrop GL. DIP original experiment: DIP-252208X Structure (London, England : 1993) 2013 IMEx The three-dimensional structure of the biotin carboxylase-biotin carboxyl carrier protein complex of E. coli acetyl-CoA carboxylase. accc_ecoli Biotin carboxylase accC fabG b3256 Acetyl-CoA carboxylase subunit A JW3224 protein protein ecoli Escherichia coli (strain K12) MLDKIVIANRGEIALRILRACKELGIKTVAVHSSADRDLKHVLLADETVCIGPAPSVKSYLNIPAIISAAEITGAVAIHPGYGFLSENANFAEQVERSGFIFIGPKAETIRLMGDKVSAIAAMKKAGVPCVPGSDGPLGDDMDKNRAIAKRIGYPVIIKASGGGGGRGMRVVRGDAELAQSISMTRAEAKAAFSNDMVYMEKYLENPRHVEIQVLADGQGNAIYLAERDCSMQRRHQKVVEEAPAPGITPELRRYIGERCAKACVDIGYRGAGTFEFLFENGEFYFIEMNTRIQVEHPVTEMITGVDLIKEQLRIAAGQPLSIKQEEVHVRGHAVECRINAEDPNTFLPSPGKITRFHAPGGFGVRWESHIYAGYTVPPYYDSMIGKLICYGENRDVAIARMKNALQELIIDGIKTNVDLQIRIMNDENFQHGGTNIHYLEKKLGLQEK DIP protein P24182 original sequence version: 108 DIP protein P24182 original sequence version: 139 DIP protein P24182 original sequence version: null 68C55F10ACB4F170 bccp_ecoli Biotin carboxyl carrier protein of acetyl-CoA carboxylase accB fabE b3255 JW3223 protein protein ecoli Escherichia coli (strain K12) MDIRKIKKLIELVEESGISELEISEGEESVRISRAAPAASFPVMQQAYAAPMMQQPAQSNAAAPATVPSMEAPAAAEISGHIVRSPMVGTFYRTPSPDAKAFIEVGQKVNVGDTLCIVEAMKMMNQIEADKSGTVKAILVESGQPVEFDEPLVVIE DIP protein P0ABD8 original sequence version: 68 05FFDCB912A683A3 accb-accc-1 2 4 unspecified role unspecified role prey prey ecolx Escherichia coli 5 unspecified role unspecified role bait bait His-tag His-tag his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range ecolx Escherichia coli physical association physical association accb-accc-2 3 4 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli 5 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli direct interaction direct interaction accb-accc-3 1 4 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli 5 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli direct interaction direct interaction