IntAct European Bioinformatics Institute IntAct intact http://www.ebi.ac.uk/ http://www.ebi.ac.uk/intact/query/${ac} EBI-[0-9]+|IA:[0-9]+ INTerAction database (IntAct) provides an open source database and toolkit for the storage, presentation and analysis of molecular interactions. http://www.ebi.ac.uk/intact European Bioinformatics Institute; Wellcome Trust Genome Campus; Hinxton, Cambridge; CB10 1SD; United Kingdom http://www.ebi.ac.uk/intact/ Pregnancy-specific glycoproteins bind integrin αIIbβ3 and inhibit the platelet-fibrinogen interaction. Pregnancy-specific glycoproteins bind integrin αIIbβ3 and inhibit the platelet-fibrinogen interaction. PloS one 2012 imex curation Shanley DK., Kiely PA., Golla K., Allen S., Martin K., O'Riordan RT., Ball M., Aplin JD., Singer BB., Caplice N., Moran N., Moore T. Complex portal already has interactors Fibrinogen and Integrin alphaIIb-beta3 complex -EBI-2554508 nmoran@rcsi.ie, t.moore@ucc.ie 15-Nov-2017: Contacted by IntAct-Help. Only protein-protein interactions imex curation in vitro In vitro anti bait coip anti bait coimmunoprecipitation anti bait coip anti tag western anti tag western blot anti tag western Shanley DK., Kiely PA., Golla K., Allen S., Martin K., O'Riordan RT., Ball M., Aplin JD., Singer BB., Caplice N., Moran N., Moore T. Calbiochem integrins alpha2b/beta3 have the alternate name of "glycoprotein GPIIb/IIIa" and were isolated from human serum. Complex portal already has interactors Fibrinogen and Integrin alphaIIb-beta3 complex -EBI-2554508 nmoran@rcsi.ie, t.moore@ucc.ie Accepted 2017-SEP-15 AT 15:44 BST AT 15:44 BST by PPORRAS PloS one 2012 Only protein-protein interactions imex curation imex curation Mock publication and experiment for abstract interactions that are not interaction evidences. Mock publication and experiment for abstract interactions that are not interaction evidences. unspecified method Pregnancy-specific glycoproteins bind integrin αIIbβ3 and inhibit the platelet-fibrinogen interaction. Pregnancy-specific glycoproteins bind integrin αIIbβ3 and inhibit the platelet-fibrinogen interaction. PloS one 2012 imex curation Shanley DK., Kiely PA., Golla K., Allen S., Martin K., O'Riordan RT., Ball M., Aplin JD., Singer BB., Caplice N., Moran N., Moore T. Complex portal already has interactors Fibrinogen and Integrin alphaIIb-beta3 complex -EBI-2554508 nmoran@rcsi.ie, t.moore@ucc.ie 15-Nov-2017: Contacted by IntAct-Help. Only protein-protein interactions imex curation in vitro In vitro anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Shanley DK., Kiely PA., Golla K., Allen S., Martin K., O'Riordan RT., Ball M., Aplin JD., Singer BB., Caplice N., Moran N., Moore T. Calbiochem integrins alpha2b/beta3 have the alternate name of "glycoprotein GPIIb/IIIa" and were isolated from human serum. Complex portal already has interactors Fibrinogen and Integrin alphaIIb-beta3 complex -EBI-2554508 nmoran@rcsi.ie, t.moore@ucc.ie Accepted 2017-SEP-15 AT 15:44 BST AT 15:44 BST by PPORRAS PloS one 2012 Only protein-protein interactions imex curation imex curation p11464-1 Pregnancy-specific beta-1-glycoprotein 1 CD66 antigen-like family member F Fetal liver non-specific cross-reactive antigen 1/2 PSG95 Pregnancy-specific beta-1 glycoprotein C/D PSG-1a PSG1 B1G1 PSBG1 PSGGA protein protein human Homo sapiens Human MGTLSAPPCTQRIKWKGLLLTASLLNFWNLPTTAQVTIEAEPTKVSEGKDVLLLVHNLPQNLTGYIWYKGQMRDLYHYITSYVVDGEIIIYGPAYSGRETAYSNASLLIQNVTREDAGSYTLHIIKGDDGTRGVTGRFTFTLHLETPKPSISSSNLNPRETMEAVSLTCDPETPDASYLWWMNGQSLPMTHSLKLSETNRTLFLLGVTKYTAGPYECEIRNPVSASRSDPVTLNLLPKLPKPYITINNLNPRENKDVLNFTCEPKSENYTYIWWLNGQSLPVSPRVKRPIENRILILPSVTRNETGPYQCEIRDRYGGIRSDPVTLNVLYGPDLPRIYPSFTYYRSGEVLYLSCSADSNPPAQYSWTINEKFQLPGQKLFIRHITTKHSGLYVCSVRNSATGKESSKSMTVEVSDWTVP 5E9855162F0C796D ita2b_human Integrin alpha-IIb Platelet membrane glycoprotein IIb GPalpha IIb ITGA2B GP2B ITGAB protein protein human Homo sapiens Human MARALCPLQALWLLEWVLLLLGPCAAPPAWALNLDPVQLTFYAGPNGSQFGFSLDFHKDSHGRVAIVVGAPRTLGPSQEETGGVFLCPWRAEGGQCPSLLFDLRDETRNVGSQTLQTFKARQGLGASVVSWSDVIVACAPWQHWNVLEKTEEAEKTPVGSCFLAQPESGRRAEYSPCRGNTLSRIYVENDFSWDKRYCEAGFSSVVTQAGELVLGAPGGYYFLGLLAQAPVADIFSSYRPGILLWHVSSQSLSFDSSNPEYFDGYWGYSVAVGEFDGDLNTTEYVVGAPTWSWTLGAVEILDSYYQRLHRLRGEQMASYFGHSVAVTDVNGDGRHDLLVGAPLYMESRADRKLAEVGRVYLFLQPRGPHALGAPSLLLTGTQLYGRFGSAIAPLGDLDRDGYNDIAVAAPYGGPSGRGQVLVFLGQSEGLRSRPSQVLDSPFPTGSAFGFSLRGAVDIDDNGYPDLIVGAYGANQVAVYRAQPVVKASVQLLVQDSLNPAVKSCVLPQTKTPVSCFNIQMCVGATGHNIPQKLSLNAELQLDRQKPRQGRRVLLLGSQQAGTTLNLDLGGKHSPICHTTMAFLRDEADFRDKLSPIVLSLNVSLPPTEAGMAPAVVLHGDTHVQEQTRIVLDCGEDDVCVPQLQLTASVTGSPLLVGADNVLELQMDAANEGEGAYEAELAVHLPQGAHYMRALSNVEGFERLICNQKKENETRVVLCELGNPMKKNAQIGIAMLVSVGNLEEAGESVSFQLQIRSKNSQNPNSKIVLLDVPVRAEAQVELRGNSFPASLVVAAEEGEREQNSLDSWGPKVEHTYELHNNGPGTVNGLHLSIHLPGQSQPSDLLYILDIQPQGGLQCFPQPPVNPLKVDWGLPIPSPSPIHPAHHKRDRRQIFLPEPEQPSRLQDPVLVSCDSAPCTVVQCDLQEMARGQRAMVTVLAFLWLPSLYQRPLDQFVLQSHAWFNVSSLPYAVPPLSLPRGEAQVWTQLLRALEERAIPIWWVLVGVLGGLLLLTILVLAMWKVGFFKRNRPPLEEDDEEGE 063EE298E026F116 itb3_human Integrin beta-3 Platelet membrane glycoprotein IIIa ITGB3 GP3A protein protein human Homo sapiens Human MRARPRPRPLWATVLALGALAGVGVGGPNICTTRGVSSCQQCLAVSPMCAWCSDEALPLGSPRCDLKENLLKDNCAPESIEFPVSEARVLEDRPLSDKGSGDSSQVTQVSPQRIALRLRPDDSKNFSIQVRQVEDYPVDIYYLMDLSYSMKDDLWSIQNLGTKLATQMRKLTSNLRIGFGAFVDKPVSPYMYISPPEALENPCYDMKTTCLPMFGYKHVLTLTDQVTRFNEEVKKQSVSRNRDAPEGGFDAIMQATVCDEKIGWRNDASHLLVFTTDAKTHIALDGRLAGIVQPNDGQCHVGSDNHYSASTTMDYPSLGLMTEKLSQKNINLIFAVTENVVNLYQNYSELIPGTTVGVLSMDSSNVLQLIVDAYGKIRSKVELEVRDLPEELSLSFNATCLNNEVIPGLKSCMGLKIGDTVSFSIEAKVRGCPQEKEKSFTIKPVGFKDSLIVQVTFDCDCACQAQAEPNSHRCNNGNGTFECGVCRCGPGWLGSQCECSEEDYRPSQQDECSPREGQPVCSQRGECLCGQCVCHSSDFGKITGKYCECDDFSCVRYKGEMCSGHGQCSCGDCLCDSDWTGYYCNCTTRTDTCMSSNGLLCSGRGKCECGSCVCIQPGSYGDTCEKCPTCPDACTFKKECVECKKFDRGALHDENTCNRYCRDEIESVKELKDTGKDAVNCTYKNEDDCVVRFQYYEDSSGKSILYVVEEPECPKGPDILVVLLSVMGAILLIGLAALLIWKLLITIHDRKEFAKFEEERARAKWDTANNPLYKEATSTFTNITYRGT DIP protein P05106 original sequence version: 202 DIP protein P05106-1 original sequence version: 158 DIP protein P05106-1 original sequence version: 164 DIP protein P05106 original sequence version: 200 DIP protein P05106-1 original sequence version: 213 DIP protein P05106-1 original sequence version: 175 DIP protein P05106-1 original sequence version: 192 DIP protein P05106-1 original sequence version: 171 F246623608E05F9E 35e65e46-1 1 4 unspecified role unspecified role prey prey c_terminus his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range c_terminus v5 tag v5 tag GKPIPNPLLGLDST epitope tag GKPIPNPLLGLDST epitope tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range Delta_N_construct sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain certain certain sequence position certain certain certain sequence position certain ecoli Escherichia coli (strain K12) 13 unspecified role unspecified role bait bait human-serum Homo sapiens serum Serum physical association physical association 2B intg_a2b_b3_human-psg1-1 3 4 unspecified role unspecified role prey prey c_terminus his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range c_terminus v5 tag v5 tag GKPIPNPLLGLDST epitope tag GKPIPNPLLGLDST epitope tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range ecoli Escherichia coli (strain K12) 13 unspecified role unspecified role bait bait crigr-cho chinese hamster ovary cell line cho chinese hamster ovary cell line Also called LR73 cells. physical association physical association 2Ai intg_a2b_b3_human-psg1-3 3 4 unspecified role unspecified role prey prey c_terminus his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range c_terminus v5 tag v5 tag GKPIPNPLLGLDST epitope tag GKPIPNPLLGLDST epitope tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range ecoli Escherichia coli (strain K12) 13 unspecified role unspecified role bait bait human-serum Homo sapiens serum Serum physical association physical association 2 A intg_a2b_b3_human-psg1-2 3 4 unspecified role unspecified role prey prey c_terminus his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range c_terminus v5 tag v5 tag GKPIPNPLLGLDST epitope tag GKPIPNPLLGLDST epitope tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range N_terminal_region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain P11464-1:p.Lys126_Asp128delinsAlaAlaAla mutation with no effect mutation with no effect mutation with no effect mutation not affecting interaction certain certain sequence position certain certain certain sequence position certain KGD AAA Wed May 02 19:30:07 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'lys_gly_asp126-128ala_ala_ala' Tue Jun 30 15:45:58 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Lys126_Asp128delinsAlaAlaAla' ecoli Escherichia coli (strain K12) 13 unspecified role unspecified role bait bait human-serum Homo sapiens serum Serum physical association physical association Supp 5 N_terminal_region only showed weak interaction. intg_a2b_b3_human Integrin alpha-2b/beta-3 alpha2b-beta3 integrin complex alpha-2b/beta-3 integrin complex alpha-IIb/beta-3 integrin complex integrin alpha2b-beta3 complex ITGA2B:ITGB3 Integrin alphaIIb-beta3 complex 6 unspecified role unspecified role ita2b binding region binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain 5 unspecified role unspecified role itb3 binding region binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain 32 34 direct interaction direct interaction human Homo sapiens Human stable complex stable complex physical interaction evidence used in manual assertion physical interaction evidence used in manual assertion IPI inferred from physical interaction Glanzmann thrombasthenia - a disease of platelet aggregation characterized by mucocutaneous bleeding of mild-to-moderate severity. Cell adhesion, bi-directional signaling receptor which functions as a link between the extra-cellular matrix and the cytoskeleton. Integrin alphaIIb-beta3 is the most abundant surface-expressed integrin (40,000-80,000 copies per platelet) with another pool located in internal membranes and which can be exposed after platelet activation. Receptor for von Willebrand factor, fibronectin, fibrinogen, plasminogen, prothrombin, thrombospondin and vitronectin. It recognizes the sequence R-G-D in a wide array of ligands or H-H-L-G-G-G-A-K-Q-A-G-D-V in the case of fibrinogen gamma chain. Following activation integrin alpha-IIb/beta-3 brings about platelet/platelet interaction through binding of soluble fibrinogen. This step leads to rapid platelet aggregation which physically plugs ruptured endothelial cell surface. Heterodimer of an alpha and a beta subunit. The alpha subunit is composed of an heavy and a light chain linked by a disulfide bond. The ligand-binding site forms in a region at the intersection of the integrin alpha-chain beta-propeller and the betaI domain, with the alpha chain being central in determining ligand specificity. Heterodimer created with intact-jami-dbscripts