DIP Database of Interacting Proteins 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ dip@mbi.ucla.edu A safeguard mechanism regulates Rho GTPases to coordinate cytokinesis with the establishment of cell polarity. A safeguard mechanism regulates Rho GTPases to coordinate cytokinesis with the establishment of cell polarity. PLoS biology 2012 imex curation Meitinger F., Richter H., Heisel S., Hub B., Seufert W., Pereira G. Only protein-protein interactions yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast pull down pull down anti tag western anti tag western blot anti tag western Meitinger F., Richter H., Heisel S., Hub B., Seufert W., Pereira G. DIP original experiment: DIP-251946X PLoS biology 2012 IMEx A safeguard mechanism regulates Rho GTPases to coordinate cytokinesis with the establishment of cell polarity. A safeguard mechanism regulates Rho GTPases to coordinate cytokinesis with the establishment of cell polarity. A safeguard mechanism regulates Rho GTPases to coordinate cytokinesis with the establishment of cell polarity. PLoS biology 2012 imex curation Meitinger F., Richter H., Heisel S., Hub B., Seufert W., Pereira G. Only protein-protein interactions in vitro In vitro pull down pull down anti tag western anti tag western blot anti tag western Meitinger F., Richter H., Heisel S., Hub B., Seufert W., Pereira G. DIP original experiment: DIP-251945X PLoS biology 2012 IMEx A safeguard mechanism regulates Rho GTPases to coordinate cytokinesis with the establishment of cell polarity. A safeguard mechanism regulates Rho GTPases to coordinate cytokinesis with the establishment of cell polarity. A safeguard mechanism regulates Rho GTPases to coordinate cytokinesis with the establishment of cell polarity. PLoS biology 2012 imex curation Meitinger F., Richter H., Heisel S., Hub B., Seufert W., Pereira G. Only protein-protein interactions in vitro In vitro pull down pull down predetermined predetermined participant predetermined Meitinger F., Richter H., Heisel S., Hub B., Seufert W., Pereira G. DIP original experiment: DIP-251944X PLoS biology 2012 IMEx A safeguard mechanism regulates Rho GTPases to coordinate cytokinesis with the establishment of cell polarity. A safeguard mechanism regulates Rho GTPases to coordinate cytokinesis with the establishment of cell polarity. A safeguard mechanism regulates Rho GTPases to coordinate cytokinesis with the establishment of cell polarity. PLoS biology 2012 imex curation Meitinger F., Richter H., Heisel S., Hub B., Seufert W., Pereira G. Only protein-protein interactions yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid predetermined predetermined participant predetermined Meitinger F., Richter H., Heisel S., Hub B., Seufert W., Pereira G. DIP original experiment: DIP-251942X PLoS biology 2012 IMEx A safeguard mechanism regulates Rho GTPases to coordinate cytokinesis with the establishment of cell polarity. A safeguard mechanism regulates Rho GTPases to coordinate cytokinesis with the establishment of cell polarity. A safeguard mechanism regulates Rho GTPases to coordinate cytokinesis with the establishment of cell polarity. PLoS biology 2012 imex curation Meitinger F., Richter H., Heisel S., Hub B., Seufert W., Pereira G. Only protein-protein interactions yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid predetermined predetermined participant predetermined Meitinger F., Richter H., Heisel S., Hub B., Seufert W., Pereira G. DIP original experiment: DIP-251943X PLoS biology 2012 IMEx A safeguard mechanism regulates Rho GTPases to coordinate cytokinesis with the establishment of cell polarity. A safeguard mechanism regulates Rho GTPases to coordinate cytokinesis with the establishment of cell polarity. A safeguard mechanism regulates Rho GTPases to coordinate cytokinesis with the establishment of cell polarity. PLoS biology 2012 imex curation Meitinger F., Richter H., Heisel S., Hub B., Seufert W., Pereira G. Only protein-protein interactions yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast pull down pull down ms participant Identification by mass spectrometry ms participant Meitinger F., Richter H., Heisel S., Hub B., Seufert W., Pereira G. DIP original experiment: DIP-251947X PLoS biology 2012 IMEx A safeguard mechanism regulates Rho GTPases to coordinate cytokinesis with the establishment of cell polarity. fks1_yeast 1,3-beta-glucan synthase component FKS1 CND1 CWH53 ETG1 GSC1 PBR1 L8300.6 YLR342W FKS1 GLS1 1,3-beta-D-glucan-UDP glucosyltransferase FK506 sensitivity protein 1 Calcineurin dependent protein 1 Calcofluor white hypersensitivity protein 53 Echinocandin target gene protein 1 Glucan synthase of cerevisiae protein 1 Papulacandin B resistance protein 1 protein protein yeast Saccharomyces cerevisiae Baker's yeast MNTDQQPYQGQTDYTQGPGNGQSQEQDYDQYGQPLYPSQADGYYDPNVAAGTEADMYGQQPPNESYDQDYTNGEYYGQPPNMAAQDGENFSDFSSYGPPGTPGYDSYGGQYTASQMSYGEPNSSGTSTPIYGNYDPNAIAMALPNEPYPAWTADSQSPVSIEQIEDIFIDLTNRLGFQRDSMRNMFDHFMVLLDSRSSRMSPDQALLSLHADYIGGDTANYKKWYFAAQLDMDDEIGFRNMSLGKLSRKARKAKKKNKKAMEEANPEDTEETLNKIEGDNSLEAADFRWKAKMNQLSPLERVRHIALYLLCWGEANQVRFTAECLCFIYKCALDYLDSPLCQQRQEPMPEGDFLNRVITPIYHFIRNQVYEIVDGRFVKRERDHNKIVGYDDLNQLFWYPEGIAKIVLEDGTKLIELPLEERYLRLGDVVWDDVFFKTYKETRTWLHLVTNFNRIWVMHISIFWMYFAYNSPTFYTHNYQQLVDNQPLAAYKWASCALGGTVASLIQIVATLCEWSFVPRKWAGAQHLSRRFWFLCIIFGINLGPIIFVFAYDKDTVYSTAAHVVAAVMFFVAVATIIFFSIMPLGGLFTSYMKKSTRRYVASQTFTAAFAPLHGLDRWMSYLVWVTVFAAKYSESYYFLVLSLRDPIRILSTTAMRCTGEYWWGAVLCKVQPKIVLGLVIATDFILFFLDTYLWYIIVNTIFSVGKSFYLGISILTPWRNIFTRLPKRIYSKILATTDMEIKYKPKVLISQVWNAIIISMYREHLLAIDHVQKLLYHQVPSEIEGKRTLRAPTFFVSQDDNNFETEFFPRDSEAERRISFFAQSLSTPIPEPLPVDNMPTFTVLTPHYAERILLSLREIIREDDQFSRVTLLEYLKQLHPVEWECFVKDTKILAEETAAYEGNENEAEKEDALKSQIDDLPFYCIGFKSAAPEYTLRTRIWASLRSQTLYRTISGFMNYSRAIKLLYRVENPEIVQMFGGNAEGLERELEKMARRKFKFLVSMQRLAKFKPHELENAEFLLRAYPDLQIAYLDEEPPLTEGEEPRIYSALIDGHCEILDNGRRRPKFRVQLSGNPILGDGKSDNQNHALIFYRGEYIQLIDANQDNYLEECLKIRSVLAEFEELNVEQVNPYAPGLRYEEQTTNHPVAIVGAREYIFSENSGVLGDVAAGKEQTFGTLFARTLSQIGGKLHYGHPDFINATFMTTRGGVSKAQKGLHLNEDIYAGMNAMLRGGRIKHCEYYQCGKGRDLGFGTILNFTTKIGAGMGEQMLSREYYYLGTQLPVDRFLTFYYAHPGFHLNNLFIQLSLQMFMLTLVNLSSLAHESIMCIYDRNKPKTDVLVPIGCYNFQPAVDWVRRYTLSIFIVFWIAFVPIVVQELIERGLWKATQRFFCHLLSLSPMFEVFAGQIYSSALLSDLAIGGARYISTGRGFATSRIPFSILYSRFAGSAIYMGARSMLMLLFGTVAHWQAPLLWFWASLSSLIFAPFVFNPHQFAWEDFFLDYRDYIRWLSRGNNQYHRNSWIGYVRMSRARITGFKRKLVGDESEKAAGDASRAHRTNLIMAEIIPCAIYAAGCFIAFTFINAQTGVKTTDDDRVNSVLRIIICTLAPIAVNLGVLFFCMGMSCCSGPLFGMCCKKTGSVMAGIAHGVAVIVHIAFFIVMWVLESFNFVRMLIGVVTCIQCQRLIFHCMTALMLTREFKNDHANTAFWTGKWYGKGMGYMAWTQPSRELTAKVIELSEFAADFVLGHVILICQLPLIIIPKIDKFHSIMLFWLKPSRQIRPPIYSLKQTRLRKRMVKKYCSLYFLVLAIFAGCIIGPAVASAKIHKHIGDSLDGVVHNLFQPINTTNNDTGSQMSTYQSHYYTHTPSLKTWSTIK AD4B4CB8CB28B5D8 AD4B4CB8CB28B5D8 aim44_yeast Altered inheritance of mitochondria protein 44 P2570 YPL158C AIM44 protein protein yeast Saccharomyces cerevisiae Baker's yeast MIIRAPIRTKTKSFRGDQMDFKFPSNESLPRGTLEEYHLNNHHLLNDVFAAENGVSRDEDGNSQTLSDYTSTSNTNTNSGYSSNGYYSFANISDNTTSSPRIVINQNETARLTSSDSNKSDFFASHDFPGNDSLHYSSSNVVKNQLHSMEAIPEGNITGSISTAFQTIPTADNVSYDIAPSSASSLLPRKSTSKSAILPSTQEAKPMTKLNMEKDIKTIELNNSVVPKPKKKLNRVPTIRRVESSRFSNSRYSSSVSSKSSSSRCSLKRSKAIRCKGGLLYYFTSLGIKIKKKLRKLRLVLRRRLFSYNVQKVPSATNSKTTKSKANINNKSKKRGTNLVNKNSNSTPRQKKSQRYVSNLQRSISSKSLVPVLAPQKKTKPLTVDTKFKANHPQSEDSKVGSNTPRSPLVSYTPSLRRTNSSIRRAASILTASATMTPANNKNSFISVPDNVSHAVTRNSSMYSRSRLVRSKPSTALNAIARQPSIVVENKVIPLSMNRYSIKEEDEYVIDTSSMRELSPVNSVCSSDYDRESSESYSNYADAMETTEVDNKDRVECNNEIQNVDANNEETSNEESYNLMKHYLSTVIAQRIMLRVQIARIQNYKSNVVYMNKSAETNSTIYEDLVDSLLTEYEADGSSSQIFDGVTVRADEEEEEDEDDEDDEEEEEENDDEEDEEDEEDDEDDEEEEEKRKEGEGRNLAKEVDELAELSPMRKQSDLSITLRSPFAMLNPAYSNSIISLPTGVVKRSLTLPVGMKI 3B4FA92B91C87F2B 3B4FA92B91C87F2B cdc42_yeast Cell division control protein 42 CDC42 SRO2 YLR229C L8083.13 Suppressor of RHO3 protein 2 protein protein yeast Saccharomyces cerevisiae Baker's yeast MQTLKCVVVGDGAVGKTCLLISYTTNQFPADYVPTVFDNYAVTVMIGDEPYTLGLFDTAGQEDYDRLRPLSYPSTDVFLVCFSVISPPSFENVKEKWFPEVHHHCPGVPCLVVGTQIDLRDDKVIIEKLQRQRLRPITSEQGSRLARELKAVKYVECSALTQRGLKNVFDEAIVAALEPPVIKKSKKCAIL 30BD644BA9836B2C 30BD644BA9836B2C nis1_yeast Protein NIS1 YNL078W N2337 NIS1 JIP1 Neck protein interacting with septins protein 1 Jumonji domain-interacting protein 1 protein protein yeast Saccharomyces cerevisiae Baker's yeast METYETSIGTQSYPPTLFPPPLGTGGFTTSGYIHALVDSTSNSNSNSNTNSNTNSNTNSNSDTKIPIVQISDDSHITHDSFKPYMEYHDASHLRNRNISKADQVESTEVMEQFTQWSNYKMRSRSPTINAKPIRHTSQRRTDFTSKNELSKFSKNHNFIFHKGFLKRQHSIRREDRQAKVRSRFRSKKELTSVLNYIELEQMDIANVLASQPVNLHAIRNLTSRDPAVTPIPFLRSQMYATSSRPPYLRNRSISRKLPKSQPGSLPTTMPATATKTIKQNSTTPTTRSVYNKNVGRSNTSPSVLYHPKRRGKLNTKSHARKEQLLLELWREYLMLVITQRTQLRLTLLCSPGSASNESSVCSSNASDLDMSLLSTPSSLFQMAGETKSNPIIIPDSQDDSILSSDPF 925C7B6063BCE4F1 925C7B6063BCE4F1 nap1_yeast Nucleosome assembly protein NAP1 YKR048C protein protein yeast Saccharomyces cerevisiae Baker's yeast MSDPIRTKPKSSMQIDNAPTPHNTPASVLNPSYLKNGNPVRAQAQEQDDKIGTINEEDILANQPLLLQSIQDRLGSLVGQDSGYVGGLPKNVKEKLLSLKTLQSELFEVEKEFQVEMFELENKFLQKYKPIWEQRSRIISGQEQPKPEQIAKGQEIVESLNETELLVDEEEKAQNDSEEEQVKGIPSFWLTALENLPIVCDTITDRDAEVLEYLQDIGLEYLTDGRPGFKLLFRFDSSANPFFTNDILCKTYFYQKELGYSGDFIYDHAEGCEISWKDNAHNVTVDLEMRKQRNKTTKQVRTIEKITPIESFFNFFDPPKIQNEDQDEELEEDLEERLALDYSIGEQLKDKLIPRAVDWFTGAALEFEFEEDEEEADEDEDEEEDDDHGLEDDDGESAEEQDDFAGRPEQAPECKQS C0F97FBA1B9EEA83 C0F97FBA1B9EEA83 rho1_yeast GTP-binding protein RHO1 RHO1 YPR165W P9325.3 Rho-type GTPase 1 protein protein yeast Saccharomyces cerevisiae Baker's yeast MSQQVGNSIRRKLVIVGDGACGKTCLLIVFSKGQFPEVYVPTVFENYVADVEVDGRRVELALWDTAGQEDYDRLRPLSYPDSNVVLICFSIDLPDSLENVQEKWIAEVLHFCQGVPIILVGCKVDLRNDPQTIEQLRQEGQQPVTSQEGQSVADQIGATGYYECSAKTGYGVREVFEAATRASLMGKSKTNGKAKKNTTEKKKKKCVLL 630B17E9E34CFE75 630B17E9E34CFE75 nba1_yeast Protein NBA1 YOL070C NBA1 NAP1 and bud neck-associated protein 1 protein protein yeast Saccharomyces cerevisiae Baker's yeast MSEEREENGISRATLNTQRLSAMIDSLNNEKDDRLFPSPTTTRTMITEEKADQSDVFKPPSRLLRSPAGDVSLPPGDNRSSMISNYSGIIQEGVEVSYVVKNRQQTQERRTSKDSNSLYSLKEPVSKNELPSLPMLPSEATLTKHLSDNQSTKSNTNADEIVIKPVTNAKPVGRFNSNTSKKVEGRGSLKLLSSPLRQEKVMRSSIGSGNLASESGSSTYNTKFHQSIQEQLEEEEEGNVSDKLSIVSSVIPELYTTTNEAPKAINPIRSETNDYNPTIPPRSKDRPRSRLFIEEGDGEGDLLTEEILPTPVQPGGHYKNSSQISTVSEQKSESYYSAATSMPPEEETYLTRPLPSTPNEDSRVTSNLKRDDTLKAIHDRANHTSTSTNKQDDDMYEDIIEETPKKTKLKKDTKKKLNKKKSVKELRSFDIDTLNQLLSVTKGTLIGSEFAQLGMKIEEKRALERLVDSLSRLTADMVLDPDRYEEGLKRLDKATKALEGF 8128246D00B9C03D 8128246D00B9C03D rho1-gps1-1 4 8 unspecified role unspecified role prey prey Region 1-290 Region 1-290 sufficient to bind sufficient binding region sufficient to bind deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 12 unspecified role unspecified role bait bait yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast physical association physical association gps1-cdc42-1 1 9 unspecified role unspecified role prey prey HA-tag HA-tag ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 8 unspecified role unspecified role bait bait TAP-tag TAP-tag tandem tag tandem tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast physical association physical association cdc42-gps1-1 5 9 unspecified role unspecified role bait bait yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 8 unspecified role unspecified role prey prey Region 1-290 Region 1-290 sufficient to bind sufficient binding region sufficient to bind deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast physical association physical association gps1-cdc42-2 2 9 unspecified role unspecified role prey prey GST-tag GST-tag gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range ecolx Escherichia coli 8 unspecified role unspecified role bait bait Region 1-290 Region 1-290 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain His-tag His-tag his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range ecolx Escherichia coli direct interaction direct interaction gps1-fks1-1 6 7 unspecified role unspecified role prey prey yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 10 unspecified role unspecified role prey prey yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 11 unspecified role unspecified role prey prey yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 13 unspecified role unspecified role prey prey yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 12 unspecified role unspecified role prey prey yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 8 unspecified role unspecified role bait bait TAP-tag TAP-tag tandem tag tandem tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast association association gps1-rho1-1 3 8 unspecified role unspecified role bait bait Region 1-290 Region 1-290 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain His-tag His-tag his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range ecolx Escherichia coli 12 unspecified role unspecified role prey prey GST-tag GST-tag gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range ecolx Escherichia coli direct interaction direct interaction