DIP Database of Interacting Proteins 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ dip@mbi.ucla.edu The molecular mechanism of substrate engagement and immunosuppressant inhibition of calcineurin. The molecular mechanism of substrate engagement and immunosuppressant inhibition of calcineurin. PLoS biology 2012 imex curation Grigoriu S., Bond R., Cossio P., Chen JA., Ly N., Hummer G., Page R., Cyert MS., Peti W. Only protein-protein interactions in vitro In vitro pull down pull down anti tag western anti tag western blot anti tag western Grigoriu S., Bond R., Cossio P., Chen JA., Ly N., Hummer G., Page R., Cyert MS., Peti W. DIP original experiment: DIP-251940X PLoS biology 2012 IMEx The molecular mechanism of substrate engagement and immunosuppressant inhibition of calcineurin. The molecular mechanism of substrate engagement and immunosuppressant inhibition of calcineurin. The molecular mechanism of substrate engagement and immunosuppressant inhibition of calcineurin. PLoS biology 2012 imex curation Grigoriu S., Bond R., Cossio P., Chen JA., Ly N., Hummer G., Page R., Cyert MS., Peti W. Only protein-protein interactions in vitro In vitro x-ray diffraction x-ray crystallography X-ray X-ray x-ray diffraction predetermined predetermined participant predetermined Grigoriu S., Bond R., Cossio P., Chen JA., Ly N., Hummer G., Page R., Cyert MS., Peti W. DIP original experiment: DIP-251938X PLoS biology 2012 IMEx The molecular mechanism of substrate engagement and immunosuppressant inhibition of calcineurin. The molecular mechanism of substrate engagement and immunosuppressant inhibition of calcineurin. The molecular mechanism of substrate engagement and immunosuppressant inhibition of calcineurin. PLoS biology 2012 imex curation Grigoriu S., Bond R., Cossio P., Chen JA., Ly N., Hummer G., Page R., Cyert MS., Peti W. Only protein-protein interactions ecolx Escherichia coli molecular sieving molecular sieving Gel Filtration Size Exclusion Chromatography Size Exclusion Chromatography Gel Filtration Sizing column predetermined predetermined participant predetermined Grigoriu S., Bond R., Cossio P., Chen JA., Ly N., Hummer G., Page R., Cyert MS., Peti W. DIP original experiment: DIP-251937X PLoS biology 2012 IMEx The molecular mechanism of substrate engagement and immunosuppressant inhibition of calcineurin. The molecular mechanism of substrate engagement and immunosuppressant inhibition of calcineurin. The molecular mechanism of substrate engagement and immunosuppressant inhibition of calcineurin. PLoS biology 2012 imex curation Grigoriu S., Bond R., Cossio P., Chen JA., Ly N., Hummer G., Page R., Cyert MS., Peti W. Only protein-protein interactions in vitro In vitro pull down pull down anti tag western anti tag western blot anti tag western Grigoriu S., Bond R., Cossio P., Chen JA., Ly N., Hummer G., Page R., Cyert MS., Peti W. DIP original experiment: DIP-251939X PLoS biology 2012 IMEx The molecular mechanism of substrate engagement and immunosuppressant inhibition of calcineurin. The molecular mechanism of substrate engagement and immunosuppressant inhibition of calcineurin. The molecular mechanism of substrate engagement and immunosuppressant inhibition of calcineurin. PLoS biology 2012 imex curation Grigoriu S., Bond R., Cossio P., Chen JA., Ly N., Hummer G., Page R., Cyert MS., Peti W. Only protein-protein interactions in vitro In vitro molecular sieving molecular sieving Gel Filtration Size Exclusion Chromatography Size Exclusion Chromatography Gel Filtration Sizing column predetermined predetermined participant predetermined Grigoriu S., Bond R., Cossio P., Chen JA., Ly N., Hummer G., Page R., Cyert MS., Peti W. DIP original experiment: DIP-251936X PLoS biology 2012 IMEx The molecular mechanism of substrate engagement and immunosuppressant inhibition of calcineurin. The molecular mechanism of substrate engagement and immunosuppressant inhibition of calcineurin. The molecular mechanism of substrate engagement and immunosuppressant inhibition of calcineurin. PLoS biology 2012 imex curation Grigoriu S., Bond R., Cossio P., Chen JA., Ly N., Hummer G., Page R., Cyert MS., Peti W. Only protein-protein interactions in vitro In vitro pull down pull down anti tag western anti tag western blot anti tag western Grigoriu S., Bond R., Cossio P., Chen JA., Ly N., Hummer G., Page R., Cyert MS., Peti W. DIP original experiment: DIP-251941X PLoS biology 2012 IMEx The molecular mechanism of substrate engagement and immunosuppressant inhibition of calcineurin. nfac1_human Nuclear factor of activated T-cells, cytoplasmic 1 NFATC1 NFAT2 NFATC NFAT transcription complex cytosolic component protein protein human Homo sapiens Human MPSTSFPVPSKFPLGPAAAVFGRGETLGPAPRAGGTMKSAEEEHYGYASSNVSPALPLPTAHSTLPAPCHNLQTSTPGIIPPADHPSGYGAALDGGPAGYFLSSGHTRPDGAPALESPRIEITSCLGLYHNNNQFFHDVEVEDVLPSSKRSPSTATLSLPSLEAYRDPSCLSPASSLSSRSCNSEASSYESNYSYPYASPQTSPWQSPCVSPKTTDPEEGFPRGLGACTLLGSPRHSPSTSPRASVTEESWLGARSSRPASPCNKRKYSLNGRQPPYSPHHSPTPSPHGSPRVSVTDDSWLGNTTQYTSSAIVAAINALTTDSSLDLGDGVPVKSRKTTLEQPPSVALKVEPVGEDLGSPPPPADFAPEDYSSFQHIRKGGFCDQYLAVPQHPYQWAKPKPLSPTSYMSPTLPALDWQLPSHSGPYELRIEVQPKSHHRAHYETEGSRGAVKASAGGHPIVQLHGYLENEPLMLQLFIGTADDRLLRPHAFYQVHRITGKTVSTTSHEAILSNTKVLEIPLLPENSMRAVIDCAGILKLRNSDIELRKGETDIGRKNTRVRLVFRVHVPQPSGRTLSLQVASNPIECSQRSAQELPLVEKQSTDSYPVVGGKKMVLSGHNFLQDSKVIFVEKAPDGHHVWEMEAKTDRDLCKPNSLVVEIPPFRNQRITSPVHVSFYVCNGKRKRSQYQRFTYLPANVPIIKTEPTDDYEPAPTCGPVSQGLSPLPRPYYSQQLAMPPDPSSCLVAGFPPCPQRSTLMPAAPGVSPKLHDLSPAAYTKGVASPGHCHLGLPQPAGEAPAVQDVPRPVATHPGSPGQPPPALLPQQVSAPPSSSCPPGLEHSLCPSSPSPPLPPATQEPTCLQPCSPACPPATGRPQHLPSTVRRDESPTAGPRLLPEVHEDGSPNLAPIPVTVKREPEELDQLYLDDVNEIIRNDLSSTSTHS DIP protein O95644 original sequence version: 141 DIP protein O95644 original sequence version: 156 E72FAB10ECEB2D66 canb1_human Calcineurin subunit B type 1 PPP3R1 CNA2 CNB Protein phosphatase 2B regulatory subunit 1 Protein phosphatase 3 regulatory subunit B alpha isoform 1 protein protein human Homo sapiens Human MGNEASYPLEMCSHFDADEIKRLGKRFKKLDLDNSGSLSVEEFMSLPELQQNPLVQRVIDIFDTDGNGEVDFKEFIEGVSQFSVKGDKEQKLRFAFRIYDMDKDGYISNGELFQVLKMMVGNNLKDTQLQQIVDKTIINADKDGDGRISFEEFCAVVGGLDIHKKMVVDV DIP protein P63098 original sequence version: 100 DIP protein P63098 original sequence version: 117 DIP protein P63098 original sequence version: 91 C904715DC0386056 q08209-1 Serine/threonine-protein phosphatase 2B catalytic subunit alpha isoform PPP3CA CALNA CNA CAM-PRP catalytic subunit Calmodulin-dependent calcineurin A subunit alpha isoform protein protein human Homo sapiens Human MSEPKAIDPKLSTTDRVVKAVPFPPSHRLTAKEVFDNDGKPRVDILKAHLMKEGRLEESVALRIITEGASILRQEKNLLDIDAPVTVCGDIHGQFFDLMKLFEVGGSPANTRYLFLGDYVDRGYFSIECVLYLWALKILYPKTLFLLRGNHECRHLTEYFTFKQECKIKYSERVYDACMDAFDCLPLAALMNQQFLCVHGGLSPEINTLDDIRKLDRFKEPPAYGPMCDILWSDPLEDFGNEKTQEHFTHNTVRGCSYFYSYPAVCEFLQHNNLLSILRAHEAQDAGYRMYRKSQTTGFPSLITIFSAPNYLDVYNNKAAVLKYENNVMNIRQFNCSPHPYWLPNFMDVFTWSLPFVGEKVTEMLVNVLNICSDDELGSEEDGFDGATAAARKEVIRNKIRAIGKMARVFSVLREESESVLTLKGLTPTGMLPSGVLSGGKQTLQSATVEAIEADEAIKGFSPQHKITSFEEAKGLDRINERMPPRRDAMPSDANLNSINKALTSETNGTDSNGSNSSNIQ DIP protein Q08209-1 original sequence version: 73 ikbl_asfm2 IkB-like protein A238L Ankyrin repeat domain-containing protein A238L p28 5EL Mal-047 protein protein asfm2 African swine fever virus (isolate Tick/Malawi/Lil 20-1/1983) ASFV MDTIGLFSVEAEHLFVEWVKKCIKKGDLTLFETLFNADPWIVNRCNKNKITVFMLICIYGRLDFLRFLFKQESYPGEIVNHYRRDKDGNSAWHYLAEKNNHLLLEEVLDYFGKNGIRVCFPNFNGVTPIMKAAMRGRTLSVLSLLKYGANPNRKDYLKGFTTWDWAVFTGHADLVKTLNKGYQKPLFMHFPLYKLDVFHRRFKKKPKIIITGCEDNVYEKLPEQNSNFLCVKKLNKYGK DIP protein O36972 original sequence version: 53 ppp3ca-ppp3r1-12 5 10 unspecified role unspecified role unspecified role unspecified role Region 200-239 Region 200-239 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain ecolx Escherichia coli 8 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli 9 unspecified role unspecified role unspecified role unspecified role Region 1-370 Region 1-370 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain ecolx Escherichia coli physical association physical association ppp3ca-ppp3r1-13 2 10 unspecified role unspecified role unspecified role unspecified role Region 200-239 Region 200-239 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain ecolx Escherichia coli 8 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli 9 unspecified role unspecified role unspecified role unspecified role Region 1-370 Region 1-370 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain ecolx Escherichia coli direct interaction direct interaction vf238_asfm2-ppp3ca-1 1 10 unspecified role unspecified role bait bait Region 225-239 Region 225-239 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain GST-tag GST-tag gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range O36972:p.[Phe228Ala;Leu229Ala;Val231Ala;Lys232Ala] F228A/L229A/V231A/K232A mutation disrupting strength mutation disrupting interaction strength mutation disrupting strength alanine scanning alanine scanning certain certain sequence position certain certain certain sequence position certain K A certain certain sequence position certain certain certain sequence position certain V A certain certain sequence position certain certain certain sequence position certain L A certain certain sequence position certain certain certain sequence position certain F A This feature has been corrected as a result of our quality control procedures. The original label was 'F228A/L229A/V231A/K232A'. Wed May 02 16:29:02 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'phe228ala,leu229ala,val231ala,lys232ala' Tue Jun 30 17:21:30 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.[Phe228Ala;Leu229Ala;Val231Ala;Lys232Ala]' ecolx Escherichia coli 9 unspecified role unspecified role prey prey His-tag His-tag his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range ecolx Escherichia coli physical association physical association ppp3ca-ppp3r1-14 3 8 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli 9 unspecified role unspecified role unspecified role unspecified role Region 1-370 Region 1-370 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain ecolx Escherichia coli direct interaction direct interaction ppp3ca-vf238_asfm2-1 4 10 unspecified role unspecified role prey prey Region 157-239 Region 157-239 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain S-tag S-tag s tag s tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range ecolx Escherichia coli 9 unspecified role unspecified role bait bait GST-tag GST-tag gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range ecolx Escherichia coli physical association physical association nfatc1-ppp3ca-2 6 7 unspecified role unspecified role bait bait Region 384-398 Region 384-398 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain GST-tag GST-tag gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range ecolx Escherichia coli 9 unspecified role unspecified role prey prey His-tag His-tag his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range ecolx Escherichia coli physical association physical association