DIP Database of Interacting Proteins 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ dip@mbi.ucla.edu Structural insights into the mechanism of GTPase activation in the GIMAP family. Structural insights into the mechanism of GTPase activation in the GIMAP family. Structure (London, England : 1993) 2013 imex curation Schwefel D., Arasu BS., Marino SF., Lamprecht B., Köchert K., Rosenbaum E., Eichhorst J., Wiesner B., Behlke J., Rocks O., Mathas S., Daumke O. Only protein-protein interactions in vitro In vitro solution sedimentati cosedimentation in solution solution sedimentati predetermined predetermined participant predetermined Schwefel D., Arasu BS., Marino SF., Lamprecht B., Köchert K., Rosenbaum E., Eichhorst J., Wiesner B., Behlke J., Rocks O., Mathas S., Daumke O. DIP original experiment: DIP-252191X Structure (London, England : 1993) 2013 IMEx Structural insights into the mechanism of GTPase activation in the GIMAP family. Structural insights into the mechanism of GTPase activation in the GIMAP family. Structural insights into the mechanism of GTPase activation in the GIMAP family. Structure (London, England : 1993) 2013 imex curation Schwefel D., Arasu BS., Marino SF., Lamprecht B., Köchert K., Rosenbaum E., Eichhorst J., Wiesner B., Behlke J., Rocks O., Mathas S., Daumke O. Only protein-protein interactions in vitro In vitro gtpase assay gtpase assay GTPase gtp hydrolisis gtp hydrolisis GTPase predetermined predetermined participant predetermined Schwefel D., Arasu BS., Marino SF., Lamprecht B., Köchert K., Rosenbaum E., Eichhorst J., Wiesner B., Behlke J., Rocks O., Mathas S., Daumke O. DIP original experiment: DIP-252194X Structure (London, England : 1993) 2013 IMEx Structural insights into the mechanism of GTPase activation in the GIMAP family. Structural insights into the mechanism of GTPase activation in the GIMAP family. Structural insights into the mechanism of GTPase activation in the GIMAP family. Structure (London, England : 1993) 2013 imex curation Schwefel D., Arasu BS., Marino SF., Lamprecht B., Köchert K., Rosenbaum E., Eichhorst J., Wiesner B., Behlke J., Rocks O., Mathas S., Daumke O. Only protein-protein interactions in vitro In vitro gtpase assay gtpase assay GTPase gtp hydrolisis gtp hydrolisis GTPase predetermined predetermined participant predetermined Schwefel D., Arasu BS., Marino SF., Lamprecht B., Köchert K., Rosenbaum E., Eichhorst J., Wiesner B., Behlke J., Rocks O., Mathas S., Daumke O. DIP original experiment: DIP-252193X Structure (London, England : 1993) 2013 IMEx Structural insights into the mechanism of GTPase activation in the GIMAP family. Structural insights into the mechanism of GTPase activation in the GIMAP family. Structural insights into the mechanism of GTPase activation in the GIMAP family. Structure (London, England : 1993) 2013 imex curation Schwefel D., Arasu BS., Marino SF., Lamprecht B., Köchert K., Rosenbaum E., Eichhorst J., Wiesner B., Behlke J., Rocks O., Mathas S., Daumke O. Only protein-protein interactions in vitro In vitro x-ray diffraction x-ray crystallography X-ray X-ray x-ray diffraction predetermined predetermined participant predetermined Schwefel D., Arasu BS., Marino SF., Lamprecht B., Köchert K., Rosenbaum E., Eichhorst J., Wiesner B., Behlke J., Rocks O., Mathas S., Daumke O. DIP original experiment: DIP-252192X Structure (London, England : 1993) 2013 IMEx Structural insights into the mechanism of GTPase activation in the GIMAP family. gima7_human GTPase IMAP family member 7 GIMAP7 IAN7 Immunity-associated nucleotide 7 protein protein protein human Homo sapiens Human MAESEDRSLRIVLVGKTGSGKSATANTILGEEIFDSRIAAQAVTKNCQKASREWQGRDLLVVDTPGLFDTKESLDTTCKEISRCIISSCPGPHAIVLVLLLGRYTEEEQKTVALIKAVFGKSAMKHMVILFTRKEELEGQSFHDFIADADVGLKSIVKECGNRCCAFSNSKKTSKAEKESQVQELVELIEKMVQCNEGAYFSDDIYKDTEERLKQREEVLRKIYTDQLNEEIKLVEEDKHKSEEEKEKEIKLLKLKYDEKIKNIREEAERNIFKDVFNRIWKMLSEIWHRFLSKCKFYSS DIP protein Q8NHV1 original sequence version: 75 gima2_human GTPase IMAP family member 2 GIMAP2 IMAP2 Immunity-associated protein 2 protein protein human Homo sapiens Human MDQNEHSHWGPHAKGQCASRSELRIILVGKTGTGKSAAGNSILRKQAFESKLGSQTLTKTCSKSQGSWGNREIVIIDTPDMFSWKDHCEALYKEVQRCYLLSAPGPHVLLLVTQLGRYTSQDQQAAQRVKEIFGEDAMGHTIVLFTHKEDLNGGSLMDYMHDSDNKALSKLVAACGGRICAFNNRAEGSNQDDQVKELMDCIEDLLMEKNGDHYTNGLYSLIQRSKCGPVGSDERVKEFKQSLIKYMETQRSYTALAEANCLKGALIKTQLCVLFCIQLFLRLIILWLCILHSMCNLFCCLLFSMCNLFCSLLFIIPKKLMIFLRTVIRLERKTPRL DIP protein Q9UG22 original sequence version: 71 DIP protein Q9UG22 original sequence version: 83 gimap7-1 1 5 unspecified role unspecified role unspecified role unspecified role Q8NHV1:p.Glu136Trp E136W mutation decreasing strength mutation decreasing interaction strength mutation decreasing strength substitut analysis substitution analysis substitut analysis certain certain sequence position certain certain certain sequence position certain E W This feature has been corrected as a result of our quality control procedures. The original label was 'E136W'. Wed May 02 15:23:44 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'glu136trp' Tue Jun 30 19:47:38 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Glu136Trp' ecolx Escherichia coli direct interaction direct interaction gimap2-gimap7-1 2 6 unspecified role unspecified role unspecified role unspecified role Q9UG22:p.Arg117Asp R117D mutation disrupting strength mutation disrupting interaction strength mutation disrupting strength substitut analysis substitution analysis substitut analysis certain certain sequence position certain certain certain sequence position certain R D This feature has been corrected as a result of our quality control procedures. The original label was 'R117D'. Wed May 02 17:42:06 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'arg117asp' Tue Jun 30 17:15:26 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Arg117Asp' Q9UG22:p.Ser54Ala S54A mutation disrupting strength mutation disrupting interaction strength mutation disrupting strength alanine scanning alanine scanning certain certain sequence position certain certain certain sequence position certain S A This feature has been corrected as a result of our quality control procedures. The original label was 'S54A'. Wed May 02 18:47:13 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'ser54ala' Tue Jun 30 18:09:57 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Ser54Ala' ecolx Escherichia coli 5 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli direct interaction direct interaction gimap7-2 4 5 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli direct interaction direct interaction gimap2-gimap7-2 3 6 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli 5 unspecified role unspecified role unspecified role unspecified role Q8NHV1:p.Glu136Trp E136W mutation decreasing strength mutation decreasing interaction strength mutation decreasing strength substitut analysis substitution analysis substitut analysis certain certain sequence position certain certain certain sequence position certain E W This feature has been corrected as a result of our quality control procedures. The original label was 'E136W'. Wed May 02 15:37:06 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'glu136trp' Tue Jun 30 16:24:11 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Glu136Trp' Q8NHV1:p.Arg103Asp R103D mutation disrupting strength mutation disrupting interaction strength mutation disrupting strength substitut analysis substitution analysis substitut analysis certain certain sequence position certain certain certain sequence position certain R D This feature has been corrected as a result of our quality control procedures. The original label was 'R103D'. Wed May 02 17:06:36 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'arg103asp' Tue Jun 30 19:06:57 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Arg103Asp' ecolx Escherichia coli direct interaction direct interaction