DIP Database of Interacting Proteins 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ dip@mbi.ucla.edu Crystal structure of the entire respiratory complex I. Crystal structure of the entire respiratory complex I. Nature 2013 imex curation Baradaran R., Berrisford JM., Minhas GS., Sazanov LA. Only protein-protein interactions thet8 Thermus thermophilus (strain HB8 / ATCC 27634 / DSM 579) x-ray diffraction x-ray crystallography X-ray X-ray x-ray diffraction predetermined predetermined participant predetermined Baradaran R., Berrisford JM., Minhas GS., Sazanov LA. DIP original experiment: DIP-252098X Nature 2013 IMEx Crystal structure of the entire respiratory complex I. Crystal structure of the entire respiratory complex I. Crystal structure of the entire respiratory complex I. Nature 2013 imex curation Baradaran R., Berrisford JM., Minhas GS., Sazanov LA. Only protein-protein interactions thet8 Thermus thermophilus (strain HB8 / ATCC 27634 / DSM 579) x-ray diffraction x-ray crystallography X-ray X-ray x-ray diffraction predetermined predetermined participant predetermined Baradaran R., Berrisford JM., Minhas GS., Sazanov LA. DIP original experiment: DIP-252099X Nature 2013 IMEx Crystal structure of the entire respiratory complex I. nqo2_thet8 NADH-quinone oxidoreductase subunit 2 nqo2 NADH dehydrogenase I chain 2 NDH-1 subunit 2 TTHA0088 protein protein thet8 Thermus thermophilus (strain HB8 / ATCC 27634 / DSM 579) MGFFDDKQDFLEETFAKYPPEGRRAAIMPLLRRVQQEEGWIRPERIEEIARLVGTTPTEVMGVASFYSYYQFVPTGKYHLQVCATLSCKLAGAEELWDYLTETLGIGPGEVTPDGLFSVQKVECLGSCHTAPVIQVNDEPYVECVTRARLEALLAGLRAGKRLEEIELPGKCGHHVHEVEV DIP protein Q56221 original sequence version: 78 DIP protein Q56221 original sequence version: 101 484FE09245C613EE nqo5_thet8 NADH-quinone oxidoreductase subunit 5 nqo5 NADH dehydrogenase I chain 5 NDH-1 subunit 5 TTHA0086 protein protein thet8 Thermus thermophilus (strain HB8 / ATCC 27634 / DSM 579) MRLERVLEEARAKGYPIEDNGLGNLWVVLPRERFKEEMAHYKAMGFNFLADIVGLDYLTYPDPRPERFAVVYELVSLPGWKDGDGSRFFVRVYVPEEDPRLPTVTDLWGSANFLEREVYDLFGIVFEGHPDLRKILTPEDLEGHPLRKDYPLGETPTLFREGRYIIPAEFRAALTGKDPGLTFYKGGSRKGYRSLWADLKKAREVKG DIP protein Q56219 original sequence version: 69 DIP protein Q56219 original sequence version: 87 EB6891BEF6F314AD nqo14_thet8 NADH-quinone oxidoreductase subunit 14 nqo14 NADH dehydrogenase I chain 14 NDH-1 subunit 14 TTHA0097 protein protein thet8 Thermus thermophilus (strain HB8 / ATCC 27634 / DSM 579) MTLAILAVFSVALTLLGFVLPPQGVKRATLLGLALALASLLLTWGKPFAFGPYAVDGVSQVFTLLALLGALWTVGLVRSGRFEFYLLVLYAALGMHLLASTRHLLLMLVALEALSLPLYALATWRRGQGLEAALKYFLLGALAAAFFLYGAALFYGATGSLVLGAPGEGPLYALALGLLLVGLGFKAALAPFHFWTPDVYQGSPTPVVLFMATSVKAAAFAALLRVAAPPEALALLVALSVVVGNLAALAQKEAKRLLAYSSIAHAGYMALALYTGNAQALGFYLLTYVLATGLAFAVLSQISPDRVPLEALRGLYRKDPLLGLAFLVAMLSLLGLPPLAGFWGKYLAFAEAARAGAWGVLVLALVTSAVSAYYYLGLGLAVFARPEETPFRPGPPWARAAVVAAGVLLLALGLLPGLVLPALAAGG DIP protein Q56229 original sequence version: 68 DIP protein Q56229 original sequence version: 86 nqo9_thet8 NADH-quinone oxidoreductase subunit 9 nqo9 NADH dehydrogenase I subunit 9 NDH-1 subunit 9 TTHA0092 protein protein thet8 Thermus thermophilus (strain HB8 / ATCC 27634 / DSM 579) MTLKALAQSLGITLKYLFSKPVTVPYPDAPVALKPRFHGRHVLTRHPNGLEKCIGCSLCAAACPAYAIYVEPAENDPENPVSAGERYAKVYEINMLRCIFCGLCEEACPTGAIVLGYDFEMADYEYSDLVYGKEDMLVDVVGTKPQRREAKRTGKPVKVGYVVPYVRPELEGFKAPTEGGKR DIP protein Q56224 original sequence version: 86 DIP protein Q56224 original sequence version: 104 054A9F7942C64C66 nqo11_thet8 NADH-quinone oxidoreductase subunit 11 nqo11 NADH dehydrogenase I chain 11 NDH-1 subunit 11 TTHA0094 protein protein thet8 Thermus thermophilus (strain HB8 / ATCC 27634 / DSM 579) MSYLLTSALLFALGVYGVLTRRTAILVFLSIELMLNAANLSLVGFARAYGLDGQVAALMVIAVAAAEVAVGLGLIVAIFRHRESTAVDDLSELRG DIP protein Q56226 original sequence version: 66 DIP protein Q56226 original sequence version: 83 nqo12_thet8 NADH-quinone oxidoreductase subunit 12 nqo12 NADH dehydrogenase I chain 12 NDH-1 subunit 12 TTHA0095 protein protein thet8 Thermus thermophilus (strain HB8 / ATCC 27634 / DSM 579) MALLGTILLPLLGFALLGLFGKRMREPLPGVLASGLVLASFLLGAGLLLSGGARFQAEWLPGIPFSLLLDNLSGFMLLIVTGVGFLIHVYAIGYMGGDPGYSRFFAYFNLFIAMMLTLVLADSYPVMFIGWEGVGLASFLLIGFWYKNPQYADSARKAFIVNRIGDLGFMLGMAILWALYGTLSISELKEAMEGPLKNPDLLALAGLLLFLGAVGKSAQIPLMVWLPDAMAGPTPVSALIHAATMVTAGVYLIARSSFLYSVLPDVSYAIAVVGLLTAAYGALSAFGQTDIKKIVAYSTISQLGYMFLAAGVGAYWVALFHVFTHAFFKALLFLASGSVIHALGGEQDVRKMGGLWKHLPQTRWHALIGALALGGLPLLSGFWSKDAILAATLTYPFGGVGFYVGALLVAVLTAMYAMRWFVLVFLGEERGHHHPHEAPPVMLWPNHLLALGSVLAGYLALPHPLPNVLEPFLKPALAEVEAHHLSLGAEWGLIALSAAVALLGLWAGFVFFQRKVFPAWYLAFEAASREAFYVDRAYNALIVNPLKALAEALFYGDRGLLSGYFGLGGAARSLGQGLARLQTGYLRVYALLFVLGALLLLGVMRW DIP protein Q56227 original sequence version: 63 DIP protein Q56227 original sequence version: 80 q5si52_thet8 DUF3197 domain-containing protein TTHA1528 protein protein thet8 Thermus thermophilus (strain HB8 / ATCC 27634 / DSM 579) MVRVGMRAAPRVSLEALKAALGGLKLSEAKVYLITDWQDKRDQARYALLLHTGKKDLLVPDAFGPAFPGGEEALSELVGLLLAQGARRFYEAVVSPGEMTALLDLPPEELLKRVMAIANPTDPGIYLKRAA DIP protein Q5SI52 original sequence version: 38 nqo3_thet8 NADH-quinone oxidoreductase subunit 3 nqo3 NADH dehydrogenase I chain 3 NDH-1 subunit 3 TTHA0090 protein protein thet8 Thermus thermophilus (strain HB8 / ATCC 27634 / DSM 579) MVRVKVNDRIVEVPPGTSVMDAVFHAGYDVPLFCSEKHLSPIGACRMCLVRIGLPKKGPDGKPLLNEKGEPEIQWQPKLAASCVTAVADGMVVDTLSDVVREAQAGMVEFTLLNHPLDCPTCDKGGACELQDRTVEYGLYEKYYQKGPLELPVYTRFEFTRRHVDKHHPLSPFVILDRERCIHCKRCVRYFEEVPGDEVLDFIERGVHTFIGTMDFGLPSGFSGNITDICPVGALLDLTARFRARNWEMEETPTTCALCPVGCGITADTRSGELLRIRAREVPEVNEIWICDAGRFGHEWADQNRLKTPLVRKEGRLVEATWEEAFLALKEGLKEARGEEVGLYLAHDATLEEGLLASELAKALKTPHLDFQGRTAAPASLFPPASLEDLLQADFALVLGDPTEEAPILHLRLSEFVRDLKPPHRYNHGTPFADLQIKERMPRRTDKMALFAPYRAPLMKWAAIHEVHRPGEEREILLALLGDKEGSEMVAKAKEAWEKAKNPVLILGAGVLQDTVAAERARLLAERKGAKVLAMTPAANARGLEAMGVLPGAKGASWDEPGALYAYYGFVPPEEALKGKRFVVMHLSHLHPLAERYAHVVLPAPTFYEKRGHLVNLEGRVLPLSPAPIENGEAEGALQVLALLAEALGVRPPFRLHLEAQKALKARKVPEAMGRLSFRLKELRPKERKGAFYLRPTMWKAHQAVGKAQEAARAELWAHPETARAEALPEGAQVAVETPFGRVEARVVHREDVPKGHLYLSALGPAAGLRVEGRVLVPAGGEA DIP protein Q56223 original sequence version: 89 DIP protein Q56223 original sequence version: 106 19A56201A20F9B82 nqo1_thet8 NADH-quinone oxidoreductase subunit 1 nqo1 NADH dehydrogenase I chain 1 NDH-1 subunit 1 TTHA0089 protein protein thet8 Thermus thermophilus (strain HB8 / ATCC 27634 / DSM 579) MTGPILSGLDPRFERTLYAHVGKEGSWTLDYYLRHGGYETAKRVLKEKTPDEVIEEVKRSGLRGRGGAGFPTGLKWSFMPKDDGKQHYLICNADESEPGSFKDRYILEDVPHLLIEGMILAGYAIRATVGYIYVRGEYRRAADRLEQAIKEARARGYLGKNLFGTDFSFDLHVHRGAGAYICGEETALMNSLEGLRANPRLKPPFPAQSGLWGKPTTINNVETLASVVPIMERGADWFAQMGTEQSKGMKLYQISGPVKRPGVYELPMGTTFRELIYEWAGGPLEPIQAIIPGGSSTPPLPFTEEVLDTPMSYEHLQAKGSMLGTGGVILIPERVSMVDAMWNLTRFYAHESCGKCTPCREGVAGFMVNLFAKIGTGQGEEKDVENLEALLPLIEGRSFCPLADAAVWPVKGSLRHFKDQYLALAREKRPVPRPSLWR DIP protein Q56222 original sequence version: 74 DIP protein Q56222 original sequence version: 95 73ADB3AF31BBE4C0 nqo4_thet8 NADH-quinone oxidoreductase subunit 4 nqo4 NADH dehydrogenase I chain 4 NDH-1 subunit 4 TTHA0087 protein protein thet8 Thermus thermophilus (strain HB8 / ATCC 27634 / DSM 579) MREEFLEEIPLDAPPEEAKELRTEVMTLNVGPQHPSTHGVLRLMVTLSGEEVLEVVPHIGYLHTGFEKTMEHRTYLQNITYTPRMDYLHSFAHDLAYALAVEKLLGAVVPPRAETIRVILNELSRLASHLVFLGTGLLDLGALTPFFYAFRERETILDLFEWVTGQRFHHNYIRIGGVKEDLPEEFVPELKKLLEVLPHRIDEYEALFAESPIFYERARGVGVIPPEVAIDLGLTGGSLRASGVNYDVRKAYPYSGYETYTFDVPLGERGDVFDRMLVRIREMRESVKIIKQALERLEPGPVRDPNPQITPPPRHLLETSMEAVIYHFKHYTEGFHPPKGEVYVPTESARGELGYYIVSDGGSMPYRVKVRAPSFVNLQSLPYACKGEQVPDMVAIIASLDPVMGDVDR DIP protein Q56220 original sequence version: 70 DIP protein Q56220 original sequence version: 91 161AA0C796D62ED3 nqo15_thet8 NADH-quinone oxidoreductase subunit 15 nqo15 NADH dehydrogenase I chain 15 NDH-1 subunit 15 TTHA0496 protein protein thet8 Thermus thermophilus (strain HB8 / ATCC 27634 / DSM 579) MSASSERELYEAWVELLSWMREYAQAKGVRFEKEADFPDFIYRMERPYDLPTTIMTASLSDGLGEPFLLADVSPRHAKLKRIGLRLPRAHIHLHAHYEPGKGLVTGKIPLTKERFFALADRAREALAFA DIP protein Q5SKZ7 original sequence version: 38 DIP protein Q5SKZ7 original sequence version: 55 A944E174C0DE152C nqo7_thet8 NADH-quinone oxidoreductase subunit 7 nqo7 NADH dehydrogenase I chain 7 NDH-1 subunit 7 TTHA0084 protein protein thet8 Thermus thermophilus (strain HB8 / ATCC 27634 / DSM 579) MAPIQEYVGTLIYVGVALFIGVAALLVGALLGPKKPGRAKLMPYESGNDPAGEVKRFPVHFYVVAMLFILFDVEVAFLWPYAVSAGGLGLYGFLGVLAFTLLLFVGFLYEWWKGVMRWH DIP protein Q56217 original sequence version: 62 DIP protein Q56217 original sequence version: 80 nqo6_thet8 NADH-quinone oxidoreductase subunit 6 nqo6 NADH dehydrogenase I subunit 6 NDH-1 subunit 6 TTHA0085 protein protein thet8 Thermus thermophilus (strain HB8 / ATCC 27634 / DSM 579) MALKDLFERDVQELEREGILFTTLEKLVAWGRSNSLWPATFGLACCAIEMMASTDARNDLARFGSEVFRASPRQADVMIVAGRLSKKMAPVMRRVWEQMPDPKWVISMGACASSGGMFNNYAIVQNVDSVVPVDVYVPGCPPRPEALIYAVMQLQKKVRGQAYNERGERLPPVAAWKRTRG DIP protein Q56218 original sequence version: 72 DIP protein Q56218 original sequence version: 92 A1E030366E6692F1 nqo8_thet8 NADH-quinone oxidoreductase subunit 8 nqo8 NADH dehydrogenase I subunit 8 NDH-1 subunit 8 TTHA0091 protein protein thet8 Thermus thermophilus (strain HB8 / ATCC 27634 / DSM 579) MTWSYPVDPYWMVALKALLVVVGLLTAFAFMTLIERRLLARFQVRMGPNRVGPFGLLQPLADAIKSIFKEDIVVAQADRFLFVLAPLISVVFALLAFGLIPFGPPGSFFGYQPWVINLDLGILYLFAVSELAVYGIFLSGWASGSKYSLLGSLRSSASLISYELGLGLALLAPVLLVGSLNLNDIVNWQKEHGWLFLYAFPAFLVYLIASMAEAARTPFDLPEAEQELVGGYHTEYSSIKWALFQMAEYIHFITASALIPTLFLGGWTMPVLEVPYLWMFLKIAFFLFFFIWIRATWFRLRYDQLLRFGWGFLFPLALLWFLVTALVVALDLPRTYLLYLSALSFLVLLGAVLYTPKPARKGGGA DIP protein Q60019 original sequence version: 63 DIP protein Q60019 original sequence version: 82 nqo10_thet8 NADH-quinone oxidoreductase subunit 10 nqo10 NADH dehydrogenase I chain 10 NDH-1 subunit 10 TTHA0093 protein protein thet8 Thermus thermophilus (strain HB8 / ATCC 27634 / DSM 579) MSLLEGLALFLLLLSGVLVVTLRNAIHAALALILNFLVLAGVYVALDARFLGFIQVIVYAGAIVVLFLFVIMLLFAAQGEIGFDPLVRSRPLAALLALGVAGILAAGLWGLDLAFTQDLKGGLPQALGPLLYGDWLFVLLAVGFLLMAATVVAVALVEPGKASRAKEAEKREEVAR DIP protein Q56225 original sequence version: 62 DIP protein Q56225 original sequence version: 76 nqo13_thet8 NADH-quinone oxidoreductase subunit 13 nqo13 NADH dehydrogenase I chain 13 NDH-1 subunit 13 TTHA0096 protein protein thet8 Thermus thermophilus (strain HB8 / ATCC 27634 / DSM 579) MVVLAVLLPVVFGALLLLGLPRALGVLGAGLSFLLNLYLFLTHPGGVAHAFQAPLLPGAGVYWAFGLDGLSALFFLTIALTVFLGALVARVEGRFLGLALLMEGLLLGLFAARDLLVFYVFFEAALIPALLMLYLYGGEGRTRALYTFVLFTLVGSLPMLAAVLGARLLSGSPTFLLEDLLAHPLQEEAAFWVFLGFALAFAIKTPLFPLHAWLPPFHQENHPSGLADALGTLYKVGVFAFFRFAIPLAPEGFAQAQGLLLFLAALSALYGAWVAFAAKDFKTLLAYAGLSHMGVAALGVFSGTPEGAMGGLYLLAASGVYTGGLFLLAGRLYERTGTLEIGRYRGLAQSAPGLAALALILFLAMVGLPGLSGFPGEFLTLLGAYKASPWLAALAFLSVIASAAYALTAFQKTFWEEGGSGVKDLAGAEWGFALLSVLALLLMGVFPGYFARGLHPLAEAFAKLLGGGA DIP protein Q56228 original sequence version: 67 DIP protein Q56228 original sequence version: 84 nqo10-nqo11-1 2 5 unspecified role unspecified role unspecified role unspecified role thet8 Thermus thermophilus (strain HB8 / ATCC 27634 / DSM 579) 18 unspecified role unspecified role unspecified role unspecified role thet8 Thermus thermophilus (strain HB8 / ATCC 27634 / DSM 579) 8 unspecified role unspecified role unspecified role unspecified role thet8 Thermus thermophilus (strain HB8 / ATCC 27634 / DSM 579) 7 unspecified role unspecified role unspecified role unspecified role thet8 Thermus thermophilus (strain HB8 / ATCC 27634 / DSM 579) 17 unspecified role unspecified role unspecified role unspecified role thet8 Thermus thermophilus (strain HB8 / ATCC 27634 / DSM 579) 16 unspecified role unspecified role unspecified role unspecified role thet8 Thermus thermophilus (strain HB8 / ATCC 27634 / DSM 579) 14 unspecified role unspecified role unspecified role unspecified role thet8 Thermus thermophilus (strain HB8 / ATCC 27634 / DSM 579) physical association physical association nqo1-nqo10-3 1 9 unspecified role unspecified role unspecified role unspecified role thet8 Thermus thermophilus (strain HB8 / ATCC 27634 / DSM 579) 5 unspecified role unspecified role unspecified role unspecified role thet8 Thermus thermophilus (strain HB8 / ATCC 27634 / DSM 579) 18 unspecified role unspecified role unspecified role unspecified role thet8 Thermus thermophilus (strain HB8 / ATCC 27634 / DSM 579) 8 unspecified role unspecified role unspecified role unspecified role thet8 Thermus thermophilus (strain HB8 / ATCC 27634 / DSM 579) 7 unspecified role unspecified role unspecified role unspecified role thet8 Thermus thermophilus (strain HB8 / ATCC 27634 / DSM 579) 17 unspecified role unspecified role unspecified role unspecified role thet8 Thermus thermophilus (strain HB8 / ATCC 27634 / DSM 579) 16 unspecified role unspecified role unspecified role unspecified role thet8 Thermus thermophilus (strain HB8 / ATCC 27634 / DSM 579) 14 unspecified role unspecified role unspecified role unspecified role thet8 Thermus thermophilus (strain HB8 / ATCC 27634 / DSM 579) 13 unspecified role unspecified role unspecified role unspecified role thet8 Thermus thermophilus (strain HB8 / ATCC 27634 / DSM 579) 6 unspecified role unspecified role unspecified role unspecified role thet8 Thermus thermophilus (strain HB8 / ATCC 27634 / DSM 579) 15 unspecified role unspecified role unspecified role unspecified role thet8 Thermus thermophilus (strain HB8 / ATCC 27634 / DSM 579) 4 unspecified role unspecified role unspecified role unspecified role thet8 Thermus thermophilus (strain HB8 / ATCC 27634 / DSM 579) 12 unspecified role unspecified role unspecified role unspecified role thet8 Thermus thermophilus (strain HB8 / ATCC 27634 / DSM 579) 10 unspecified role unspecified role unspecified role unspecified role thet8 Thermus thermophilus (strain HB8 / ATCC 27634 / DSM 579) 3 unspecified role unspecified role unspecified role unspecified role thet8 Thermus thermophilus (strain HB8 / ATCC 27634 / DSM 579) 11 unspecified role unspecified role unspecified role unspecified role thet8 Thermus thermophilus (strain HB8 / ATCC 27634 / DSM 579) physical association physical association