DIP Database of Interacting Proteins 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ dip@mbi.ucla.edu Structural basis for hijacking of cellular LxxLL motifs by papillomavirus E6 oncoproteins. Structural basis for hijacking of cellular LxxLL motifs by papillomavirus E6 oncoproteins. Science (New York, N.Y.) 2013 imex curation Zanier K., Charbonnier S., Sidi AO., McEwen AG., Ferrario MG., Poussin-Courmontagne P., Cura V., Brimer N., Babah KO., Ansari T., Muller I., Stote RH., Cavarelli J., Vande Pol S., Travé G. Only protein-protein interactions yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid predetermined predetermined participant predetermined Zanier K., Charbonnier S., Sidi AO., McEwen AG., Ferrario MG., Poussin-Courmontagne P., Cura V., Brimer N., Babah KO., Ansari T., Muller I., Stote RH., Cavarelli J., Vande Pol S., Travé G. DIP original experiment: DIP-266851X Science (New York, N.Y.) 2013 IMEx Structural basis for hijacking of cellular LxxLL motifs by papillomavirus E6 oncoproteins. Structural basis for hijacking of cellular LxxLL motifs by papillomavirus E6 oncoproteins. Structural basis for hijacking of cellular LxxLL motifs by papillomavirus E6 oncoproteins. Science (New York, N.Y.) 2013 imex curation Zanier K., Charbonnier S., Sidi AO., McEwen AG., Ferrario MG., Poussin-Courmontagne P., Cura V., Brimer N., Babah KO., Ansari T., Muller I., Stote RH., Cavarelli J., Vande Pol S., Travé G. Only protein-protein interactions in vitro In vitro pull down pull down predetermined predetermined participant predetermined Zanier K., Charbonnier S., Sidi AO., McEwen AG., Ferrario MG., Poussin-Courmontagne P., Cura V., Brimer N., Babah KO., Ansari T., Muller I., Stote RH., Cavarelli J., Vande Pol S., Travé G. DIP original experiment: DIP-266853X Science (New York, N.Y.) 2013 IMEx Structural basis for hijacking of cellular LxxLL motifs by papillomavirus E6 oncoproteins. Structural basis for hijacking of cellular LxxLL motifs by papillomavirus E6 oncoproteins. Structural basis for hijacking of cellular LxxLL motifs by papillomavirus E6 oncoproteins. Science (New York, N.Y.) 2013 imex curation Zanier K., Charbonnier S., Sidi AO., McEwen AG., Ferrario MG., Poussin-Courmontagne P., Cura V., Brimer N., Babah KO., Ansari T., Muller I., Stote RH., Cavarelli J., Vande Pol S., Travé G. Only protein-protein interactions in vitro In vitro pull down pull down predetermined predetermined participant predetermined Zanier K., Charbonnier S., Sidi AO., McEwen AG., Ferrario MG., Poussin-Courmontagne P., Cura V., Brimer N., Babah KO., Ansari T., Muller I., Stote RH., Cavarelli J., Vande Pol S., Travé G. DIP original experiment: DIP-266854X Science (New York, N.Y.) 2013 IMEx Structural basis for hijacking of cellular LxxLL motifs by papillomavirus E6 oncoproteins. Structural basis for hijacking of cellular LxxLL motifs by papillomavirus E6 oncoproteins. Structural basis for hijacking of cellular LxxLL motifs by papillomavirus E6 oncoproteins. Science (New York, N.Y.) 2013 imex curation Zanier K., Charbonnier S., Sidi AO., McEwen AG., Ferrario MG., Poussin-Courmontagne P., Cura V., Brimer N., Babah KO., Ansari T., Muller I., Stote RH., Cavarelli J., Vande Pol S., Travé G. Only protein-protein interactions in vitro In vitro x-ray diffraction x-ray crystallography X-ray X-ray x-ray diffraction predetermined predetermined participant predetermined Zanier K., Charbonnier S., Sidi AO., McEwen AG., Ferrario MG., Poussin-Courmontagne P., Cura V., Brimer N., Babah KO., Ansari T., Muller I., Stote RH., Cavarelli J., Vande Pol S., Travé G. DIP original experiment: DIP-266849X Science (New York, N.Y.) 2013 IMEx Structural basis for hijacking of cellular LxxLL motifs by papillomavirus E6 oncoproteins. Structural basis for hijacking of cellular LxxLL motifs by papillomavirus E6 oncoproteins. Structural basis for hijacking of cellular LxxLL motifs by papillomavirus E6 oncoproteins. Science (New York, N.Y.) 2013 imex curation Zanier K., Charbonnier S., Sidi AO., McEwen AG., Ferrario MG., Poussin-Courmontagne P., Cura V., Brimer N., Babah KO., Ansari T., Muller I., Stote RH., Cavarelli J., Vande Pol S., Travé G. Only protein-protein interactions yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid predetermined predetermined participant predetermined Zanier K., Charbonnier S., Sidi AO., McEwen AG., Ferrario MG., Poussin-Courmontagne P., Cura V., Brimer N., Babah KO., Ansari T., Muller I., Stote RH., Cavarelli J., Vande Pol S., Travé G. DIP original experiment: DIP-266852X Science (New York, N.Y.) 2013 IMEx Structural basis for hijacking of cellular LxxLL motifs by papillomavirus E6 oncoproteins. Structural basis for hijacking of cellular LxxLL motifs by papillomavirus E6 oncoproteins. Structural basis for hijacking of cellular LxxLL motifs by papillomavirus E6 oncoproteins. Science (New York, N.Y.) 2013 imex curation Zanier K., Charbonnier S., Sidi AO., McEwen AG., Ferrario MG., Poussin-Courmontagne P., Cura V., Brimer N., Babah KO., Ansari T., Muller I., Stote RH., Cavarelli J., Vande Pol S., Travé G. Only protein-protein interactions yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid predetermined predetermined participant predetermined Zanier K., Charbonnier S., Sidi AO., McEwen AG., Ferrario MG., Poussin-Courmontagne P., Cura V., Brimer N., Babah KO., Ansari T., Muller I., Stote RH., Cavarelli J., Vande Pol S., Travé G. DIP original experiment: DIP-266850X Science (New York, N.Y.) 2013 IMEx Structural basis for hijacking of cellular LxxLL motifs by papillomavirus E6 oncoproteins. ube3a_human Ubiquitin-protein ligase E3A E6AP ubiquitin-protein ligase Oncogenic protein-associated protein E6-AP Human papillomavirus E6-associated protein Renal carcinoma antigen NY-REN-54 UBE3A E6AP EPVE6AP HPVE6A HECT-type ubiquitin transferase E3A protein protein human Homo sapiens Human MEKLHQCYWKSGEPQSDDIEASRMKRAAAKHLIERYYHQLTEGCGNEACTNEFCASCPTFLRMDNNAAAIKALELYKINAKLCDPHPSKKGASSAYLENSKGAPNNSCSEIKMNKKGARIDFKDVTYLTEEKVYEILELCREREDYSPLIRVIGRVFSSAEALVQSFRKVKQHTKEELKSLQAKDEDKDEDEKEKAACSAAAMEEDSEASSSRIGDSSQGDNNLQKLGPDDVSVDIDAIRRVYTRLLSNEKIETAFLNALVYLSPNVECDLTYHNVYSRDPNYLNLFIIVMENRNLHSPEYLEMALPLFCKAMSKLPLAAQGKLIRLWSKYNADQIRRMMETFQQLITYKVISNEFNSRNLVNDDDAIVAASKCLKMVYYANVVGGEVDTNHNEEDDEEPIPESSELTLQELLGEERRNKKGPRVDPLETELGVKTLDCRKPLIPFEEFINEPLNEVLEMDKDYTFFKVETENKFSFMTCPFILNAVTKNLGLYYDNRIRMYSERRITVLYSLVQGQQLNPYLRLKVRRDHIIDDALVRLEMIAMENPADLKKQLYVEFEGEQGVDEGGVSKEFFQLVVEEIFNPDIGMFTYDESTKLFWFNPSSFETEGQFTLIGIVLGLAIYNNCILDVHFPMVVYRKLMGKKGTFRDLGDSHPVLYQSLKDLLEYEGNVEDDMMITFQISQTDLFGNPMMYDLKENGDKIPITNENRKEFVNLYSDYILNKSVEKQFKAFRRGFHMVTNESPLKYLFRPEEIELLICGSRNLDFQALEETTEYDGGYTRDSVLIREFWEIVHSFTDEQKRLFLQFTTGTDRAPVGGLGKLKMIIAKNGPDTERLPTSHTCFNVLLLPEYSSKEKLKERLLKAITYAKGFGML DIP protein Q05086 original sequence version: 159 DIP protein Q05086-1 original sequence version: 165 DIP protein Q05086-1 original sequence version: 127 F80F0502B3B3838A ve6_bpv1 Protein E6 E6 protein protein bpv1 Bovine papillomavirus type 1 MDLKPFARTNPFSGLDCLWCREPLTEVDAFRCMVKDFHVVIREGCRYGACTICLENCLATERRLWQGVPVTGEEAELLHGKTLDRLCIRCCYCGGKLTKNEKHRHVLFNEPFCKTRANIIRGRCYDCCRHGSRSKYP DIP protein P06931 original sequence version: 84 mint Transcriptional transactivator. Binds double stranded DNA 36FADDDA55444566 ve6_hpv16 Protein E6 E6 protein protein hpv16 Human papillomavirus type 16 MHQKRTAMFQDPQERPRKLPQLCTELQTTIHDIILECVYCKQQLLRREVYDFAFRDLCIVYRDGNPYAVCDKCLKFYSKISEYRHYCYSLYGTTLEQQYNKPLCDLLIRCINCQKPLCPEEKQRHLDKKQRFHNIRGRWTGRCMSCCRSSRTRRETQL DIP protein P03126 original sequence version: 77 DIP protein P03126 original sequence version: 112 DIP protein P03126 original sequence version: 116 DIP protein P03126 original sequence version: 89 01FEF5ADCFDB37EB ptn3_human Tyrosine-protein phosphatase non-receptor type 3 Protein-tyrosine phosphatase H1 PTPN3 PTPH1 protein protein human Homo sapiens Human MTSRLRALGGRINNIRTSELPKEKTRSEVICSIHFLDGVVQTFKVTKQDTGQVLLDMVHNHLGVTEKEYFGLQHDDDSVDSPRWLEASKAIRKQLKGGFPCTLHFRVRFFIPDPNTLQQEQTRHLYFLQLKMDICEGRLTCPLNSAVVLASYAVQSHFGDYNSSIHHPGYLSDSHFIPDQNEDFLTKVESLHEQHSGLKQSEAESCYINIARTLDFYGVELHSGRDLHNLDLMIGIASAGVAVYRKYICTSFYPWVNILKISFKRKKFFIHQRQKQAESREHIVAFNMLNYRSCKNLWKSCVEHHTFFQAKKLLPQEKNVLSQYWTMGSRNTKKSVNNQYCKKVIGGMVWNPAMRRSLSVEHLETKSLPSRSPPITPNWRSPRLRHEIRKPRHSSADNLANEMTYITETEDVFYTYKGSLAPQDSDSEVSQNRSPHQESLSENNPAQSYLTQKSSSSVSPSSNAPGSCSPDGVDQQLLDDFHRVTKGGSTEDASQYYCDKNDNGDSYLVLIRITPDEDGKFGFNLKGGVDQKMPLVVSRINPESPADTCIPKLNEGDQIVLINGRDISEHTHDQVVMFIKASRESHSRELALVIRRRAVRSFADFKSEDELNQLFPEAIFPMCPEGGDTLEGSMAQLKKGLESGTVLIQFEQLYRKKPGLAITFAKLPQNLDKNRYKDVLPYDTTRVLLQGNEDYINASYVNMEIPAANLVNKYIATQGPLPHTCAQFWQVVWDQKLSLIVMLTTLTERGRTKCHQYWPDPPDVMNHGGFHIQCQSEDCTIAYVSREMLVTNTQTGEEHTVTHLQYVAWPDHGVPDDSSDFLEFVNYVRSLRVDSEPVLVHCSAGIGRTGVLVTMETAMCLTERNLPIYPLDIVRKMRDQRAMMVQTSSQYKFVCEAILRVYEEGLVQMLDPS DIP protein P26045 original sequence version: 155 DIP protein P26045-1 original sequence version: 152 44FBBFA35A5F2AFF paxi_human Paxillin PXN protein protein human Homo sapiens Human MDDLDALLADLESTTSHISKRPVFLSEETPYSYPTGNHTYQEIAVPPPVPPPPSSEALNGTILDPLDQWQPSSSRFIHQQPQSSSPVYGSSAKTSSVSNPQDSVGSPCSRVGEEEHVYSFPNKQKSAEPSPTVMSTSLGSNLSELDRLLLELNAVQHNPPGFPADEANSSPPLPGALSPLYGVPETNSPLGGKAGPLTKEKPKRNGGRGLEDVRPSVESLLDELESSVPSPVPAITVNQGEMSSPQRVTSTQQQTRISASSATRELDELMASLSDFKIQGLEQRADGERCWAAGWPRDGGRSSPGGQDEGGFMAQGKTGSSSPPGGPPKPGSQLDSMLGSLQSDLNKLGVATVAKGVCGACKKPIAGQVVTAMGKTWHPEHFVCTHCQEEIGSRNFFERDGQPYCEKDYHNLFSPRCYYCNGPILDKVVTALDRTWHPEHFFCAQCGAFFGPEGFHEKDGKAYCRKDYFDMFAPKCGGCARAILENYISALNTLWHPECFVCRECFTPFVNGSFFEHDGQPYCEVHYHERRGSLCSGCQKPITGRCITAMAKKFHPEHFVCAFCLKQLNKGTFKEQNDKPYCQNCFLKLFC DIP protein P49023 original sequence version: 115 DIP protein P49023 original sequence version: 126 DIP protein P49023 original sequence version: 169 DIP protein P49023 original sequence version: 140 DIP protein P49023 original sequence version: 175 ABF6C0BE5939623F e6-ube3a-10 4 7 unspecified role unspecified role unspecified role unspecified role Region 403-414 Region 403-414 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain MBP-tag MBP-tag mbp tag maltose binding protein tag maltose binding protein tag maltose binding protein tag mbp tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range ecolx Escherichia coli 9 unspecified role unspecified role unspecified role unspecified role Region 9-150 Region 9-150 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain ecolx Escherichia coli direct interaction direct interaction e6-ube3a-11 1 7 unspecified role unspecified role prey prey Region 401-418 Region 401-418 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 9 unspecified role unspecified role bait bait P03126:p.Leu57Ala L50A mutation disrupting strength mutation disrupting interaction strength mutation disrupting strength alanine scanning alanine scanning certain certain sequence position certain certain certain sequence position certain L A Wed May 02 20:25:54 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'leu57ala' Tue Jun 30 17:51:47 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Leu57Ala' P03126:p.Arg109Ala R102A mutation disrupting strength mutation disrupting interaction strength mutation disrupting strength alanine scanning alanine scanning certain certain sequence position certain certain certain sequence position certain R A Wed May 02 19:30:36 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'arg109ala' Tue Jun 30 20:22:05 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Arg109Ala' P03126:p.Arg138Ala R131A mutation disrupting strength mutation disrupting interaction strength mutation disrupting strength alanine scanning alanine scanning certain certain sequence position certain certain certain sequence position certain R A Wed May 02 15:04:11 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'arg138ala' Tue Jun 30 20:22:04 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Arg138Ala' P03126:p.Arg17Ala R10A mutation decreasing strength mutation decreasing interaction strength mutation decreasing strength alanine scanning alanine scanning certain certain sequence position certain certain certain sequence position certain R A Wed May 02 16:04:04 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'arg17ala' Tue Jun 30 17:40:54 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Arg17Ala' P03126:p.Arg62Ala R55A mutation decreasing strength mutation decreasing interaction strength mutation decreasing strength alanine scanning alanine scanning certain certain sequence position certain certain certain sequence position certain R A Wed May 02 14:57:29 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'arg62ala' Tue Jun 30 19:58:06 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Arg62Ala' P03126:p.Ser78Arg S71A mutation decreasing strength mutation decreasing interaction strength mutation decreasing strength alanine scanning alanine scanning certain certain sequence position certain certain certain sequence position certain S R Wed May 02 15:16:51 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'ser78arg' Tue Jun 30 15:52:09 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Ser78Arg' yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast physical association physical association e6-ptpn3-4 5 10 unspecified role unspecified role prey prey yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 9 unspecified role unspecified role bait bait yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast physical association physical association pxn-e6-3 2 8 unspecified role unspecified role prey prey P06931:p.Leu58Ser L58S mutation decreasing strength mutation decreasing interaction strength mutation decreasing strength substitut analysis substitution analysis substitut analysis certain certain sequence position certain certain certain sequence position certain L S This feature has been corrected as a result of our quality control procedures. The original label was 'L58S'. Wed May 02 18:11:47 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'leu58ser' Tue Jun 30 17:08:47 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Leu58Ser' P06931:p.Arg89Ala R89A mutation decreasing strength mutation decreasing interaction strength mutation decreasing strength alanine scanning alanine scanning certain certain sequence position certain certain certain sequence position certain R A This feature has been corrected as a result of our quality control procedures. The original label was 'R89A'. Wed May 02 15:09:34 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'arg89ala' Tue Jun 30 16:55:06 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Arg89Ala' P06931:p.Arg89Leu R89L mutation decreasing strength mutation decreasing interaction strength mutation decreasing strength substitut analysis substitution analysis substitut analysis certain certain sequence position certain certain certain sequence position certain R L This feature has been corrected as a result of our quality control procedures. The original label was 'R89L'. Wed May 02 19:14:21 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'arg89leu' Tue Jun 30 19:14:55 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Arg89Leu' P06931:p.Arg116Gly R116/G/D mutation decreasing strength mutation decreasing interaction strength mutation decreasing strength substitut analysis substitution analysis substitut analysis certain certain sequence position certain certain certain sequence position certain R G Wed May 02 16:26:36 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'arg116gly' Tue Jun 30 18:15:33 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Arg116Gly' P06931:p.Arg121Gly R121G mutation decreasing strength mutation decreasing interaction strength mutation decreasing strength substitut analysis substitution analysis substitut analysis certain certain sequence position certain certain certain sequence position certain R G This feature has been corrected as a result of our quality control procedures. The original label was 'R121G'. Wed May 02 17:34:28 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'arg121gly' Tue Jun 30 18:58:28 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Arg121Gly' P06931:p.Phe37Ser F37S mutation decreasing strength mutation decreasing interaction strength mutation decreasing strength substitut analysis substitution analysis substitut analysis certain certain sequence position certain certain certain sequence position certain F S This feature has been corrected as a result of our quality control procedures. The original label was 'F37S'. Wed May 02 16:49:52 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'phe37ser' Tue Jun 30 19:40:03 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Phe37Ser' 35S-label 35S-label 35s radiolabel 35s radiolabel 35S s35 radiolabelled S35 s35 radiolabelled 35S S35 undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined P06931:p.Arg116Asp mutation decreasing strength mutation decreasing interaction strength mutation decreasing strength certain certain sequence position certain certain certain sequence position certain R D Wed May 02 19:38:22 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'arg116asp' Tue Jun 30 19:12:31 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Arg116Asp' in vitro In vitro 11 unspecified role unspecified role bait bait Region 1-11 Region 1-11 sufficient to bind sufficient binding region sufficient to bind deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain GST-tag GST-tag gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range ecolx Escherichia coli direct interaction direct interaction e6-pxn-6 6 8 unspecified role unspecified role bait bait P06931:p.Phe37Ser F37S mutation disrupting strength mutation disrupting interaction strength mutation disrupting strength substitut analysis substitution analysis substitut analysis certain certain sequence position certain certain certain sequence position certain F S This feature has been corrected as a result of our quality control procedures. The original label was 'F37S'. Wed May 02 20:04:23 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'phe37ser' Tue Jun 30 17:39:57 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Phe37Ser' P06931:p.Leu58Ser L58S mutation disrupting strength mutation disrupting interaction strength mutation disrupting strength substitut analysis substitution analysis substitut analysis certain certain sequence position certain certain certain sequence position certain L S This feature has been corrected as a result of our quality control procedures. The original label was 'L58S'. Wed May 02 18:32:24 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'leu58ser' Tue Jun 30 17:59:22 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Leu58Ser' P06931:p.Arg89Ala R89A mutation disrupting strength mutation disrupting interaction strength mutation disrupting strength alanine scanning alanine scanning certain certain sequence position certain certain certain sequence position certain R A This feature has been corrected as a result of our quality control procedures. The original label was 'R89A'. Wed May 02 19:14:32 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'arg89ala' Tue Jun 30 19:10:04 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Arg89Ala' P06931:p.Arg89Leu R89L mutation disrupting strength mutation disrupting interaction strength mutation disrupting strength substitut analysis substitution analysis substitut analysis certain certain sequence position certain certain certain sequence position certain R L This feature has been corrected as a result of our quality control procedures. The original label was 'R89L'. Wed May 02 18:26:09 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'arg89leu' Tue Jun 30 20:20:26 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Arg89Leu' P06931:p.Arg116Gly R116/G/D mutation disrupting strength mutation disrupting interaction strength mutation disrupting strength substitut analysis substitution analysis substitut analysis certain certain sequence position certain certain certain sequence position certain R G Wed May 02 20:13:07 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'arg116gly' Tue Jun 30 19:28:47 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Arg116Gly' P06931:p.Arg121Gly R121G mutation disrupting strength mutation disrupting interaction strength mutation disrupting strength substitut analysis substitution analysis substitut analysis certain certain sequence position certain certain certain sequence position certain R G This feature has been corrected as a result of our quality control procedures. The original label was 'R121G'. Wed May 02 17:52:44 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'arg121gly' Tue Jun 30 18:40:25 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Arg121Gly' P06931:p.Arg116Asp mutation disrupting strength mutation disrupting interaction strength mutation disrupting strength certain certain sequence position certain certain certain sequence position certain R D Wed May 02 19:56:28 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'arg116asp' Tue Jun 30 17:58:49 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Arg116Asp' yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 11 unspecified role unspecified role prey prey Region 1-11 Region 1-11 sufficient to bind sufficient binding region sufficient to bind deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast physical association physical association ube3a-e6-8 3 7 unspecified role unspecified role bait bait Region 401-418 Region 401-418 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain GST-tag GST-tag gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range ecolx Escherichia coli 9 unspecified role unspecified role prey prey 35S-label 35S-label 35s radiolabel 35s radiolabel 35S s35 radiolabelled S35 s35 radiolabelled 35S S35 undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined P03126:p.Leu57Glu L50E mutation disrupting strength mutation disrupting interaction strength mutation disrupting strength substitut analysis substitution analysis substitut analysis certain certain sequence position certain certain certain sequence position certain L E Fri Jul 28 10:54:36 BST 2017 This feature has been corrected as a result of our quality control procedures. The original label was 'leu50glu' Wed May 02 20:15:20 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'leu57glu' Tue Jun 30 16:38:03 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Leu57Glu' P03126:p.Arg62Ala R55A mutation decreasing strength mutation decreasing interaction strength mutation decreasing strength alanine scanning alanine scanning certain certain sequence position certain certain certain sequence position certain R A Wed May 02 20:02:19 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'arg62ala' Tue Jun 30 16:49:19 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Arg62Ala' P03126:p.Arg138Ala R131A mutation decreasing strength mutation decreasing interaction strength mutation decreasing strength alanine scanning alanine scanning certain certain sequence position certain certain certain sequence position certain R A Wed May 02 18:23:07 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'arg138ala' Tue Jun 30 16:26:34 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Arg138Ala' P03126:p.Arg109Ala R102A mutation decreasing strength mutation decreasing interaction strength mutation decreasing strength alanine scanning alanine scanning certain certain sequence position certain certain certain sequence position certain R A Wed May 02 15:55:03 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'arg109ala' Tue Jun 30 17:23:23 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Arg109Ala' in vitro In vitro physical association physical association