DIP Database of Interacting Proteins 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ dip@mbi.ucla.edu Interaction between FIP200 and ATG16L1 distinguishes ULK1 complex-dependent and -independent autophagy. Interaction between FIP200 and ATG16L1 distinguishes ULK1 complex-dependent and -independent autophagy. Nature structural & molecular biology 2013 imex curation Gammoh N., Florey O., Overholtzer M., Jiang X. Only protein-protein interactions human Homo sapiens Human anti tag coip anti tag coimmunoprecipitation anti tag coip western blot western blot Immuno blot Immuno blot Gammoh N., Florey O., Overholtzer M., Jiang X. DIP original experiment: DIP-255509X Nature structural & molecular biology 2013 IMEx Interaction between FIP200 and ATG16L1 distinguishes ULK1 complex-dependent and -independent autophagy. Interaction between FIP200 and ATG16L1 distinguishes ULK1 complex-dependent and -independent autophagy. Interaction between FIP200 and ATG16L1 distinguishes ULK1 complex-dependent and -independent autophagy. Nature structural & molecular biology 2013 imex curation Gammoh N., Florey O., Overholtzer M., Jiang X. Only protein-protein interactions mouse Mus musculus Mouse tap tandem affinity purification TAP TAP tap ms participant Identification by mass spectrometry ms participant Gammoh N., Florey O., Overholtzer M., Jiang X. DIP original experiment: DIP-255506X Nature structural & molecular biology 2013 IMEx Interaction between FIP200 and ATG16L1 distinguishes ULK1 complex-dependent and -independent autophagy. Interaction between FIP200 and ATG16L1 distinguishes ULK1 complex-dependent and -independent autophagy. Interaction between FIP200 and ATG16L1 distinguishes ULK1 complex-dependent and -independent autophagy. Nature structural & molecular biology 2013 imex curation Gammoh N., Florey O., Overholtzer M., Jiang X. Only protein-protein interactions human Homo sapiens Human pull down pull down western blot western blot Immuno blot Immuno blot Gammoh N., Florey O., Overholtzer M., Jiang X. DIP original experiment: DIP-255519X Nature structural & molecular biology 2013 IMEx Interaction between FIP200 and ATG16L1 distinguishes ULK1 complex-dependent and -independent autophagy. Interaction between FIP200 and ATG16L1 distinguishes ULK1 complex-dependent and -independent autophagy. Interaction between FIP200 and ATG16L1 distinguishes ULK1 complex-dependent and -independent autophagy. Nature structural & molecular biology 2013 imex curation Gammoh N., Florey O., Overholtzer M., Jiang X. Only protein-protein interactions in vitro In vitro pull down pull down western blot western blot Immuno blot Immuno blot Gammoh N., Florey O., Overholtzer M., Jiang X. DIP original experiment: DIP-255512X Nature structural & molecular biology 2013 IMEx Interaction between FIP200 and ATG16L1 distinguishes ULK1 complex-dependent and -independent autophagy. Interaction between FIP200 and ATG16L1 distinguishes ULK1 complex-dependent and -independent autophagy. Interaction between FIP200 and ATG16L1 distinguishes ULK1 complex-dependent and -independent autophagy. Nature structural & molecular biology 2013 imex curation Gammoh N., Florey O., Overholtzer M., Jiang X. Only protein-protein interactions mouse Mus musculus Mouse pull down pull down western blot western blot Immuno blot Immuno blot Gammoh N., Florey O., Overholtzer M., Jiang X. DIP original experiment: DIP-255513X Nature structural & molecular biology 2013 IMEx Interaction between FIP200 and ATG16L1 distinguishes ULK1 complex-dependent and -independent autophagy. Interaction between FIP200 and ATG16L1 distinguishes ULK1 complex-dependent and -independent autophagy. Interaction between FIP200 and ATG16L1 distinguishes ULK1 complex-dependent and -independent autophagy. Nature structural & molecular biology 2013 imex curation Gammoh N., Florey O., Overholtzer M., Jiang X. Only protein-protein interactions mouse Mus musculus Mouse anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Gammoh N., Florey O., Overholtzer M., Jiang X. DIP original experiment: DIP-255507X Nature structural & molecular biology 2013 IMEx Interaction between FIP200 and ATG16L1 distinguishes ULK1 complex-dependent and -independent autophagy. Interaction between FIP200 and ATG16L1 distinguishes ULK1 complex-dependent and -independent autophagy. Interaction between FIP200 and ATG16L1 distinguishes ULK1 complex-dependent and -independent autophagy. Nature structural & molecular biology 2013 imex curation Gammoh N., Florey O., Overholtzer M., Jiang X. Only protein-protein interactions human Homo sapiens Human pull down pull down anti tag western anti tag western blot anti tag western Gammoh N., Florey O., Overholtzer M., Jiang X. DIP original experiment: DIP-255516X Nature structural & molecular biology 2013 IMEx Interaction between FIP200 and ATG16L1 distinguishes ULK1 complex-dependent and -independent autophagy. Interaction between FIP200 and ATG16L1 distinguishes ULK1 complex-dependent and -independent autophagy. Interaction between FIP200 and ATG16L1 distinguishes ULK1 complex-dependent and -independent autophagy. Nature structural & molecular biology 2013 imex curation Gammoh N., Florey O., Overholtzer M., Jiang X. Only protein-protein interactions in vitro In vitro anti bait coip anti bait coimmunoprecipitation anti bait coip predetermined predetermined participant predetermined Gammoh N., Florey O., Overholtzer M., Jiang X. DIP original experiment: DIP-255514X Nature structural & molecular biology 2013 IMEx Interaction between FIP200 and ATG16L1 distinguishes ULK1 complex-dependent and -independent autophagy. Interaction between FIP200 and ATG16L1 distinguishes ULK1 complex-dependent and -independent autophagy. Interaction between FIP200 and ATG16L1 distinguishes ULK1 complex-dependent and -independent autophagy. Nature structural & molecular biology 2013 imex curation Gammoh N., Florey O., Overholtzer M., Jiang X. Only protein-protein interactions human Homo sapiens Human pull down pull down western blot western blot Immuno blot Immuno blot Gammoh N., Florey O., Overholtzer M., Jiang X. DIP original experiment: DIP-255517X Nature structural & molecular biology 2013 IMEx Interaction between FIP200 and ATG16L1 distinguishes ULK1 complex-dependent and -independent autophagy. Interaction between FIP200 and ATG16L1 distinguishes ULK1 complex-dependent and -independent autophagy. Interaction between FIP200 and ATG16L1 distinguishes ULK1 complex-dependent and -independent autophagy. Nature structural & molecular biology 2013 imex curation Gammoh N., Florey O., Overholtzer M., Jiang X. Only protein-protein interactions human Homo sapiens Human anti tag coip anti tag coimmunoprecipitation anti tag coip western blot western blot Immuno blot Immuno blot Gammoh N., Florey O., Overholtzer M., Jiang X. DIP original experiment: DIP-255515X Nature structural & molecular biology 2013 IMEx Interaction between FIP200 and ATG16L1 distinguishes ULK1 complex-dependent and -independent autophagy. Interaction between FIP200 and ATG16L1 distinguishes ULK1 complex-dependent and -independent autophagy. Interaction between FIP200 and ATG16L1 distinguishes ULK1 complex-dependent and -independent autophagy. Nature structural & molecular biology 2013 imex curation Gammoh N., Florey O., Overholtzer M., Jiang X. Only protein-protein interactions human Homo sapiens Human pull down pull down western blot western blot Immuno blot Immuno blot Gammoh N., Florey O., Overholtzer M., Jiang X. DIP original experiment: DIP-255518X Nature structural & molecular biology 2013 IMEx Interaction between FIP200 and ATG16L1 distinguishes ULK1 complex-dependent and -independent autophagy. Interaction between FIP200 and ATG16L1 distinguishes ULK1 complex-dependent and -independent autophagy. Interaction between FIP200 and ATG16L1 distinguishes ULK1 complex-dependent and -independent autophagy. Nature structural & molecular biology 2013 imex curation Gammoh N., Florey O., Overholtzer M., Jiang X. Only protein-protein interactions human Homo sapiens Human pull down pull down western blot western blot Immuno blot Immuno blot Gammoh N., Florey O., Overholtzer M., Jiang X. DIP original experiment: DIP-255508X Nature structural & molecular biology 2013 IMEx Interaction between FIP200 and ATG16L1 distinguishes ULK1 complex-dependent and -independent autophagy. Interaction between FIP200 and ATG16L1 distinguishes ULK1 complex-dependent and -independent autophagy. Interaction between FIP200 and ATG16L1 distinguishes ULK1 complex-dependent and -independent autophagy. Nature structural & molecular biology 2013 imex curation Gammoh N., Florey O., Overholtzer M., Jiang X. Only protein-protein interactions human Homo sapiens Human pull down pull down western blot western blot Immuno blot Immuno blot Gammoh N., Florey O., Overholtzer M., Jiang X. DIP original experiment: DIP-255511X Nature structural & molecular biology 2013 IMEx Interaction between FIP200 and ATG16L1 distinguishes ULK1 complex-dependent and -independent autophagy. Interaction between FIP200 and ATG16L1 distinguishes ULK1 complex-dependent and -independent autophagy. Interaction between FIP200 and ATG16L1 distinguishes ULK1 complex-dependent and -independent autophagy. Nature structural & molecular biology 2013 imex curation Gammoh N., Florey O., Overholtzer M., Jiang X. Only protein-protein interactions human Homo sapiens Human anti tag coip anti tag coimmunoprecipitation anti tag coip western blot western blot Immuno blot Immuno blot Gammoh N., Florey O., Overholtzer M., Jiang X. DIP original experiment: DIP-255510X Nature structural & molecular biology 2013 IMEx Interaction between FIP200 and ATG16L1 distinguishes ULK1 complex-dependent and -independent autophagy. atg13_human Autophagy-related protein 13 ATG13 KIAA0652 protein protein human Homo sapiens Human METDLNSQDRKDLDKFIKFFALKTVQVIVQARLGEKICTRSSSSPTGSDWFNLAIKDIPEVTHEAKKALAGQLPAVGRSMCVEISLKTSEGDSMELEIWCLEMNEKCDKEIKVSYTVYNRLSLLLKSLLAITRVTPAYRLSRKQGHEYVILYRIYFGEVQLSGLGEGFQTVRVGTVGTPVGTITLSCAYRINLAFMSTRQFERTPPIMGIIIDHFVDRPYPSSSPMHPCNYRTAGEDTGVIYPSVEDSQEVCTTSFSTSPPSQLSSSRLSYQPAALGVGSADLAYPVVFAAGLNATHPHQLMVPGKEGGVPLAPNQPVHGTQADQERLATCTPSDRTHCAATPSSSEDTETVSNSSEGRASPHDVLETIFVRKVGAFVNKPINQVTLTSLDIPFAMFAPKNLELEDTDPMVNPPDSPETESPLQGSLHSDGSSGGSSGNTHDDFVMIDFKPAFSKDDILPMDLGTFYREFQNPPQLSSLSIDIGAQSMAEDLDSLPEKLAVHEKNVREFDAFVETLQ DIP protein O75143 original sequence version: 96 DIP protein O75143-1 original sequence version: 104 DIP protein O75143 original sequence version: 109 DIP protein O75143-1 original sequence version: 121 DIP protein O75143 original sequence version: 107 DIP protein O75143 original sequence version: 115 4D6905985EAB78A7 atg13_mouse Autophagy-related protein 13 Atg13 D2Ertd391e Kiaa0652 protein protein mouse Mus musculus Mouse METELSSQDRKDLDKFIKFFALKTVQVIVQARLGEKICTRSSSSPTGSDWFNLAIKDIPEVTHEAKKALSGQLPAVGRSMCVEISLKTSEGDSMELEIWCLEMNEKCDKEIKVSYTVYNRLSLLLKSLLAITRVTPAYRLSRKQGHEYVILYRIYFGEVQLNGLGEGFQTVRVGTVGTPVGTLTLSCAYRINLAFMSTRQFERTPPIMGIIIDHFVDRPYPSSSPMHPCNYRTAEDAGVAYPSVEDSQEVCTTSFSTSPPSQLSSSRLSYQPAVLGLGSADLAYPVVFTAGLNTTHAHQLMVPGKEGGVTLAPSHPTHGAQADPERLVMHMPSDGTHCAATPSSSEDTETVSNSSEGRASPHDILETIFVRKVGAFVNKPINQVTVTSLDIPFAMFAPKNLELEDADPMVNPPESPETTSPLHGSLHSDGSSGGSGGSTHDDFVMIDFKPAFSKDDILPMDLGTFYREFQNPPQLSSLSIDFGAQSMAEDLDSLPEKLAVHEKNVREFDAFVETLQ DIP protein Q91YI1 original sequence version: 74 DIP protein Q91YI1 original sequence version: 99 mint homomint 04B4E49BB19449F2 atg5_human Autophagy protein 5 APG5-like Apoptosis-specific protein ATG5 APG5L ASP protein protein human Homo sapiens Human MTDDKDVLRDVWFGRIPTCFTLYQDEITEREAEPYYLLLPRVSYLTLVTDKVKKHFQKVMRQEDISEIWFEYEGTPLKWHYPIGLLFDLLASSSALPWNITVHFKSFPEKDLLHCPSKDAIEAHFMSCMKEADALKHKSQVINEMQKKDHKQLWMGLQNDRFDQFWAINRKLMEYPAEENGFRYIPFRIYQTTTERPFIQKLFRPVAADGQLHTLGDLLKEVCPSAIDPEDGEKKNQVMIHGIEPMLETPLQWLSEHLSYPDNFLHISIIPQPTD DIP protein Q9H1Y0 original sequence version: 63 DIP protein Q9H1Y0 original sequence version: 56 DIP protein Q9H1Y0-1 original sequence version: 105 DIP protein Q9H1Y0 original sequence version: 105 C33A1E0B3C1DBE5C q8c0j2-3 Autophagy-related protein 16-1 Atg16l1 Apg16l Apg16Lgamma APG16-like 1 protein protein mouse Mus musculus Mouse MSSGLRAADFPRWKRHIAEELRRRDRLQRQAFEEIILQYTKLLEKSDLHSVLTQKLQAEKHDMPNRHEISPGHDGAWNDSQLQEMAQLRIKHQEELTELHKKRGELAQLVIDLNNQMQQKDKEIQMNEAKISEYLQTISDLETNCLDLRTKLQDLEVANQTLKDEYDALQITFTALEEKLRKTTEENQELVTRWMAEKAQEANRLNAENEKDSRRRQARLQKELAEAAKEPLPVEQDDDIEVIVDETSDHTEETSPVRAVSRAATKRLSQPAGGLLDSITNIFGLSESPLLGHHSSDAARRRSVSSIPVPQDIMDTHPASGKDVRVPTTASYVFDAHDGEVNAVQFSPGSRLLATGGMDRRVKLWEAFGDKCEFKGSLSGSNAGITSIEFDSAGAYLLAASNDFASRIWTVDDYRLRHTLTGHSGKVLSAKFLLDNARIVSGSHDRTLKLWDLRSKVCIKTVFAGSSCNDIVCTEQCVMSGHFDKKIRFWDIRSESVVREMELLGKITALDLNPERTELLSCSRDDLLKVIDLRTNAVKQTFSAPGFKCGSDWTRVVFSPDGSYVAAGSAEGSLYVWSVLTGKVEKVLSKQHSSSINAVAWAPSGLHVVSVDKGSRAVLWAQP DIP protein Q8C0J2-3 original sequence version: 91 a16l1_human Autophagy-related protein 16-1 APG16-like 1 UNQ9393/PRO34307 ATG16L1 APG16L protein protein human Homo sapiens Human MSSGLRAADFPRWKRHISEQLRRRDRLQRQAFEEIILQYNKLLEKSDLHSVLAQKLQAEKHDVPNRHEISPGHDGTWNDNQLQEMAQLRIKHQEELTELHKKRGELAQLVIDLNNQMQRKDREMQMNEAKIAECLQTISDLETECLDLRTKLCDLERANQTLKDEYDALQITFTALEGKLRKTTEENQELVTRWMAEKAQEANRLNAENEKDSRRRQARLQKELAEAAKEPLPVEQDDDIEVIVDETSDHTEETSPVRAISRAATKRLSQPAGGLLDSITNIFGRRSVSSFPVPQDNVDTHPGSGKEVRVPATALCVFDAHDGEVNAVQFSPGSRLLATGGMDRRVKLWEVFGEKCEFKGSLSGSNAGITSIEFDSAGSYLLAASNDFASRIWTVDDYRLRHTLTGHSGKVLSAKFLLDNARIVSGSHDRTLKLWDLRSKVCIKTVFAGSSCNDIVCTEQCVMSGHFDKKIRFWDIRSESIVREMELLGKITALDLNPERTELLSCSRDDLLKVIDLRTNAIKQTFSAPGFKCGSDWTRVVFSPDGSYVAAGSAEGSLYIWSVLTGKVEKVLSKQHSSSINAVAWSPSGSHVVSVDKGCKAVLWAQY DIP protein Q676U5 original sequence version: 96 5A5816AE2CF03CA0 rbcc1_mouse RB1-inducible coiled-coil protein 1 Coiled-coil-forming protein 1 LaXp180 Rb1cc1 Cc1 Kiaa0203 FAK family kinase-interacting protein of 200 kDa protein protein mouse Mus musculus Mouse MKLYVFLVNTGTTLTFDTELTVQTVADLKHAIQSKYKIAIQHQVLVVNGGECMAADRRVCTYSAGTDTNPIFLFNKEMILCDRAPAIPKATFSTENDMEIKVEESLMMPAVFHTVASRTQLAVEMYDVAKKLCSFCEGLVHDEHLQHQGWAAIMANLEDCSNSYQKLLFKFESIYSDYLQSIEDIKLKLTHLGTAVSVMAKIPLLECLTRHSYRECLGRPDSLNEHEGSEKAEMKRSTELVLSPDMPRTTNTSLVTSFHKSMEHVAPDPTGTERGKELRESCQSTVQQEEASVDAKDSDLPFFNVSLLDWINVQDRPNDVESLVRKCFDSMSRLDPKIIQPFMLECHQTIAKLDNQNMKAIKGLEDRLYALDQMIASCSRLVNEQKELAQGFLANQMRAENLKDASVLPDLCLSHANQLMIMLQNHRKLLDIKQKCTTAKQELANNLHVRLKWCCFVMLHADQDGEKLQALLRLVIELLERVRIVEALSTVPQMYCLAVVEVVRRKMFIKHYREWAGALVKDGKQLYEAEKSKRESFGKLFRKSFLRNRLFKGLDSWPSSFCTQKPRKFDCELPDISLKDLQFLQSFCPSEVQPFLRVPLLCDFEPLHQHVLALHNLVKAAQSLDEMSQTITDLLNEQKVSTSQASPQSAASPRIESTTGITTTTSPKTPPPLTVQDTLCPAVCPLEELSPDSIDAHTFDFETISHPNTEQPVHQASIDLDSLAESPESDFMSAVNEFVIEENLSSPNPISDPQSPEMMVESLYSSVINAIDSRRMQDTSTRGNEGFGDRAALHVQLEKCRAAAQDSHSSIQTIKDDLCHFRTFVQKEQCDLANYLKCTAVEIRNIIEKVKCSLEITLKEKHQQELQSLKIEYECKLDALVKDSEENVNKILKLKENLVSLEEALQNKDNEFTSIKHEKDAIVCVQQEKDQKLLEMEKIMHTQHCEIKELKQSREMALEDLKKLHDEKIESLRAEFQCLEQNHLKELEDTLHIRHTQEFEKVMTDHNMSLEKLKKENQQRIDQMLESHASTIQEKEQQLQELKLKVSDLSDMRCKLEVELALKEAETDEIKILLEESRTQQKEMLKSLLEQETENLRTEISKLNQKIHDNNESYQVGLSELRALMTIEKDQCISELISRHEEESNILKAELDNVTSLHRQAYEIEKKLKEQIVELQTRLNSELSALEKQKDEKITQQEEKYEALIQNLEKDKERLVKNHEQDKEHLIQELNFEKNKAVQTALDEFKVERELVEKELLEKVKHLENQIAKTPAFESAREDSSSLVAELQEKLQEEKAKFLEQLEEQEKRKNEEMQNVRTSLIAEQQTNFNTVLTREKMRKENIINDLSDKLKSTMQQQERDKDLIESLSEDRARLLEEKKQLEEEVSKLRTSSFLSSAPVAAAPELYGACAPELPGEPERSVMETADEGRLDSAMETSMMSVQENMLSEEKQRIMLLERTLQLKEEENKRLNQRLMSQSLSSVSSRHSEKIAIRDFQVGDLVLIILDERHDNYVLFTVSPTLYFLHSESLPALDLKPGEGASGASRRPWVLGKVMEKEYCQAKKAQNRFKVPLGTKFYRVKAVSWNKKV DIP protein Q9ESK9 original sequence version: 80 2D14F1434604C0AF rbcc1_human RB1-inducible coiled-coil protein 1 RB1CC1 KIAA0203 RBICC FAK family kinase-interacting protein of 200 kDa protein protein human Homo sapiens Human MKLYVFLVNTGTTLTFDTELTVQTVADLKHAIQSKYKIAIQHQVLVVNGGECMAADRRVCTYSAGTDTNPIFLFNKEMILCDRPPAIPKTTFSTENDMEIKVEESLMMPAVFHTVASRTQLALEMYEVAKKLCSFCEGLVHDEHLQHQGWAAIMANLEDCSNSYQKLLFKFESIYSNYLQSIEDIKLKLTHLGTAVSVMAKIPLLECLTRHSYRECLGRLDSLPEHEDSEKAEMKRSTELVLSPDMPRTTNESLLTSFPKSVEHVSPDTADAESGKEIRESCQSTVHQQDETTIDTKDGDLPFFNVSLLDWINVQDRPNDVESLVRKCFDSMSRLDPRIIRPFIAECRQTIAKLDNQNMKAIKGLEDRLYALDQMIASCGRLVNEQKELAQGFLANQKRAENLKDASVLPDLCLSHANQLMIMLQNHRKLLDIKQKCTTAKQELANNLHVRLKWCCFVMLHADQDGEKLQALLRLVIELLERVKIVEALSTVPQMYCLAVVEVVRRKMFIKHYREWAGALVKDGKRLYEAEKSKRESFGKLFRKSFLRNRLFRGLDSWPPSFCTQKPRKFDCELPDISLKDLQFLQSFCPSEVQPFLRVPLLCDFEPLHQHVLALHNLVKAAQSLDEMSQTITDLLSEQKASVSQTSPQSASSPRMESTAGITTTTSPRTPPPLTVQDPLCPAVCPLEELSPDSIDAHTFDFETIPHPNIEQTIHQVSLDLDSLAESPESDFMSAVNEFVIEENLSSPNPISDPQSPEMMVESLYSSVINAIDSRRMQDTNVCGKEDFGDHTSLNVQLERCRVVAQDSHFSIQTIKEDLCHFRTFVQKEQCDFSNSLKCTAVEIRNIIEKVKCSLEITLKEKHQKELLSLKNEYEGKLDGLIKETEENENKIKKLKGELVCLEEVLQNKDNEFALVKHEKEAVICLQNEKDQKLLEMENIMHSQNCEIKELKQSREIVLEDLKKLHVENDEKLQLLRAELQSLEQSHLKELEDTLQVRHIQEFEKVMTDHRVSLEELKKENQQIINQIQESHAEIIQEKEKQLQELKLKVSDLSDTRCKLEVELALKEAETDEIKILLEESRAQQKETLKSLLEQETENLRTEISKLNQKIQDNNENYQVGLAELRTLMTIEKDQCISELISRHEEESNILKAELNKVTSLHNQAFEIEKNLKEQIIELQSKLDSELSALERQKDEKITQQEEKYEAIIQNLEKDRQKLVSSQEQDREQLIQKLNCEKDEAIQTALKEFKLEREVVEKELLEKVKHLENQIAKSPAIDSTRGDSSSLVAELQEKLQEEKAKFLEQLEEQEKRKNEEMQNVRTSLIAEQQTNFNTVLTREKMRKENIINDLSDKLKSTMQQQERDKDLIESLSEDRARLLEEKKKLEEEVSKLRSSSFVPSPYVATAPELYGACAPELPGESDRSAVETADEGRVDSAMETSMMSVQENIHMLSEEKQRIMLLERTLQLKEEENKRLNQRLMSQSMSSVSSRHSEKIAIRDFQVGDLVLIILDERHDNYVLFTVSPTLYFLHSESLPALDLKPGEGASGASRRPWVLGKVMEKEYCQAKKAQNRFKVPLGTKFYRVKAVSWNKKV DIP protein Q8TDY2 original sequence version: 85 DIP protein Q8TDY2 original sequence version: 95 DIP protein Q8TDY2 original sequence version: 98 DIP protein Q8TDY2 original sequence version: 107 C9C90A328875016A ulk1_mouse Serine/threonine-protein kinase ULK1 Ulk1 Unc-51-like kinase 1 Serine/threonine-protein kinase Unc51.1 protein protein mouse Mus musculus Mouse MEPGRGGVETVGKFEFSRKDLIGHGAFAVVFKGRHREKHDLEVAVKCINKKNLAKSQTLLGKEIKILKELKHENIVALYDFQEMANSVYLVMEYCNGGDLADYLHTMRTLSEDTVRLFLQQIAGAMRLLHSKGIIHRDLKPQNILLSNPGGRRANPSNIRVKIADFGFARYLQSNMMAATLCGSPMYMAPEVIMSQHYDGKADLWSIGTIVYQCLTGKAPFQASSPQDLRLFYEKNKTLVPAIPRETSAPLRQLLLALLQRNHKDRMDFDEFFHHPFLDASTPIKKSPPVPVPSYPSSGSGSSSSSSSASHLASPPSLGEMPQLQKTLTSPADAAGFLQGSRDSGGSSKDSCDTDDFVMVPAQFPGDLVAEAASAKPPPDSLLCSGSSLVASAGLESHGRTPSPSPTCSSSPSPSGRPGPFSSNRYGASVPIPVPTQVHNYQRIEQNLQSPTQQQTARSSAIRRSGSTTPLGFGRASPSPPSHTDGAMLARKLSLGGGRPYTPSPQVGTIPERPSWSRVPSPQGADVRVGRSPRPGSSVPEHSPRTTGLGCRLHSAPNLSDFHVVRPKLPKPPTDPLGATFSPPQTSAPQPCPGLQSCRPLRGSPKLPDFLQRSPLPPILGSPTKAGPSFDFPKTPSSQNLLTLLARQGVVMTPPRNRTLPDLSEASPFHGQQLGSGLRPAEDTRGPFGRSFSTSRITDLLLKAAFGTQASDSGSTDSLQEKPMEIAPSAGFGGTLHPGARGGGASSPAPVVFTVGSPPSGATPPQSTRTRMFSVGSSSSLGSTGSSSARHLVPGACGEAPELSAPGHCCSLADPLAANLEGAVTFEAPDLPEETLMEQEHTETLHSLRFTLAFAQQVLEIAALKGSASEAAGGPEYQLQESVVADQISQLSREWGFAEQLVLYLKVAELLSSGLQTAIDQIRAGKLCLSSTVKQVVRRLNELYKASVVSCQGLSLRLQRFFLDKQRLLDGIHGVTAERLILSHAVQMVQSAALDEMFQHREGCVPRYHKALLLLEGLQHTLTDQADIENIAKCKLCIERRLSALLSGVYA DIP protein O70405 original sequence version: 110 DIP protein O70405 original sequence version: 121 DIP protein O70405 original sequence version: 128 mint homomint Involved in axon growth. Plays an essential role in neurite extension of cerebellar granule cells 99B021985FB4E8A0 a16l1_mouse Autophagy-related protein 16-1 APG16-like 1 Atg16l1 Apg16l protein protein mouse Mus musculus Mouse MSSGLRAADFPRWKRHIAEELRRRDRLQRQAFEEIILQYTKLLEKSDLHSVLTQKLQAEKHDMPNRHEISPGHDGAWNDSQLQEMAQLRIKHQEELTELHKKRGELAQLVIDLNNQMQQKDKEIQMNEAKISEYLQTISDLETNCLDLRTKLQDLEVANQTLKDEYDALQITFTALEEKLRKTTEENQELVTRWMAEKAQEANRLNAENEKDSRRRQARLQKELAEAAKEPLPVEQDDDIEVIVDETSDHTEETSPVRAVSRAATKRLSQPAGGLLDSITNIFGRRSVSSIPVPQDIMDTHPASGKDVRVPTTASYVFDAHDGEVNAVQFSPGSRLLATGGMDRRVKLWEAFGDKCEFKGSLSGSNAGITSIEFDSAGAYLLAASNDFASRIWTVDDYRLRHTLTGHSGKVLSAKFLLDNARIVSGSHDRTLKLWDLRSKVCIKTVFAGSSCNDIVCTEQCVMSGHFDKKIRFWDIRSESVVREMELLGKITALDLNPERTELLSCSRDDLLKVIDLRTNAVKQTFSAPGFKCGSDWTRVVFSPDGSYVAAGSAEGSLYVWSVLTGKVEKVLSKQHSSSINAVAWAPSGLHVVSVDKGSRAVLWAQP DIP protein Q8C0J2 original sequence version: 51 DIP protein Q8C0J2 original sequence version: 91 DIP protein Q8C0J2 original sequence version: 97 DIP protein Q8C0J2-1 original sequence version: 104 63920320883A69DF atg16l1-rb1cc1-1 2 20 unspecified role unspecified role prey prey mouse Mus musculus Mouse 18 unspecified role unspecified role bait bait TAP-tag TAP-tag tandem tag tandem tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined mouse Mus musculus Mouse physical association physical association rb1cc1-atg5-1 14 17 unspecified role unspecified role prey prey human Homo sapiens Human 21 unspecified role unspecified role bait bait Myc-tag Myc-tag myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range human Homo sapiens Human physical association physical association rb1cc1-atg16l1-3 10 19 unspecified role unspecified role prey prey human Homo sapiens Human 21 unspecified role unspecified role bait bait Myc-tag Myc-tag myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range human Homo sapiens Human physical association physical association atg16l1-rb1cc1-2 11 21 unspecified role unspecified role prey prey human Homo sapiens Human 18 unspecified role unspecified role bait bait S-tag S-tag s tag s tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined Region 229-242 Region 229-242 required to bind necessary binding region required to bind deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain human Homo sapiens Human physical association physical association atg16l1-rb1cc1-3 8 21 unspecified role unspecified role prey prey spofr Spodoptera frugiperda (Fall armyworm) Fall armyworm 18 unspecified role unspecified role bait bait ecolx Escherichia coli direct interaction direct interaction rb1cc1-atg16l1-4 6 23 unspecified role unspecified role prey prey mouse Mus musculus Mouse 20 unspecified role unspecified role bait bait mouse Mus musculus Mouse physical association physical association atg16l1-atg13-1 13 22 unspecified role unspecified role prey prey mouse Mus musculus Mouse 16 unspecified role unspecified role prey prey mouse Mus musculus Mouse 20 unspecified role unspecified role prey prey mouse Mus musculus Mouse 18 unspecified role unspecified role bait bait S-tag S-tag s tag s tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined mouse Mus musculus Mouse association association atg16l1-atg16l1-4 7 18 unspecified role unspecified role prey prey GFP-tag GFP-tag gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined human Homo sapiens Human 18 unspecified role unspecified role bait bait S-tag S-tag s tag s tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined Region 1-205 Region 1-205 required to bind necessary binding region required to bind deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain human Homo sapiens Human physical association physical association atg16l1-atg5-7 3 17 unspecified role unspecified role prey prey human Homo sapiens Human 18 unspecified role unspecified role bait bait S-tag S-tag s tag s tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined Region 1-38 Region 1-38 required to bind necessary binding region required to bind deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain human Homo sapiens Human physical association physical association atg16l1-atg13-2 12 15 unspecified role unspecified role prey prey human Homo sapiens Human 21 unspecified role unspecified role prey prey human Homo sapiens Human 18 unspecified role unspecified role bait bait S-tag S-tag s tag s tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined human Homo sapiens Human association association atg16l1-rb1cc1-4 4 21 unspecified role unspecified role prey prey spofr Spodoptera frugiperda (Fall armyworm) Fall armyworm 18 unspecified role unspecified role bait bait S-tag S-tag s tag s tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined mouse Mus musculus Mouse physical association physical association atg16l1-atg5-8 9 17 unspecified role unspecified role prey prey human Homo sapiens Human 21 unspecified role unspecified role prey prey human Homo sapiens Human 18 unspecified role unspecified role bait bait S-tag S-tag s tag s tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined Region 1-335 Region 1-335 sufficient to bind sufficient binding region sufficient to bind deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain Region 1-335 Region 1-335 required to bind necessary binding region required to bind deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain human Homo sapiens Human association association rb1cc1-atg16l1-5 1 17 unspecified role unspecified role prey prey human Homo sapiens Human 21 unspecified role unspecified role bait bait Myc-tag Myc-tag myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range human Homo sapiens Human 18 unspecified role unspecified role prey prey S-tag S-tag s tag s tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined human Homo sapiens Human association association atg16l1-rb1cc1-5 5 20 unspecified role unspecified role prey prey mouse Mus musculus Mouse 18 unspecified role unspecified role bait bait S-tag S-tag s tag s tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined mouse Mus musculus Mouse physical association physical association