DIP Database of Interacting Proteins 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ dip@mbi.ucla.edu CCR5 is a receptor for Staphylococcus aureus leukotoxin ED. CCR5 is a receptor for Staphylococcus aureus leukotoxin ED. Nature 2013 imex curation Alonzo F., Kozhaya L., Rawlings SA., Reyes-Robles T., DuMont AL., Myszka DG., Landau NR., Unutmaz D., Torres VJ. Only protein-protein interactions in vitro In vitro pull down pull down anti tag western anti tag western blot anti tag western Alonzo F., Kozhaya L., Rawlings SA., Reyes-Robles T., DuMont AL., Myszka DG., Landau NR., Unutmaz D., Torres VJ. DIP original experiment: DIP-252026X Nature 2013 IMEx CCR5 is a receptor for Staphylococcus aureus leukotoxin ED. CCR5 is a receptor for Staphylococcus aureus leukotoxin ED. CCR5 is a receptor for Staphylococcus aureus leukotoxin ED. Nature 2013 imex curation Alonzo F., Kozhaya L., Rawlings SA., Reyes-Robles T., DuMont AL., Myszka DG., Landau NR., Unutmaz D., Torres VJ. Only protein-protein interactions in vitro In vitro spr surface plasmon resonance Optical biosensor BIAcore(r) BIAcore(r) Optical biosensor spr predetermined predetermined participant predetermined Alonzo F., Kozhaya L., Rawlings SA., Reyes-Robles T., DuMont AL., Myszka DG., Landau NR., Unutmaz D., Torres VJ. DIP original experiment: DIP-252027X Nature 2013 IMEx CCR5 is a receptor for Staphylococcus aureus leukotoxin ED. luke_staau Leucotoxin LukE lukE protein protein staau Staphylococcus aureus MFKKKMLAASLSVGLIAPLASPIQESRANTNIENIGDGAEVIKRTEDVSSKKWGVTQNVQFDFVKDKKYNKDALIVKMQGFINSRTSFSDVKGRGYELTKRLIWPFQYNIGLTTKDPNVSLINSITLPKTKIETTDVGQTLGYNIGGNFQSAPSIGGNGSFNYSKTISYTQKSYVSEVDKQNSKSVKWGVKANKFVTPDGKKFAHDRYLFVQSPNGPTGSAREYFAPDNQLPPLVQSGFNPSFITTLSHEKGSKLIRVNLKFSYGRNLDITYATLFPRTGIYAERKHNAFVNRNFVVRYKVNWKTHEIKVKGHN DIP protein O54081 original sequence version: 45 ccr5_human C-C chemokine receptor type 5 HIV-1 fusion coreceptor CHEMR13 CCR5 CMKBR5 protein protein human Homo sapiens Human MDYQVSSPIYDINYYTSEPCQKINVKQIAARLLPPLYSLVFIFGFVGNMLVILILINCKRLKSMTDIYLLNLAISDLFFLLTVPFWAHYAAAQWDFGNTMCQLLTGLYFIGFFSGIFFIILLTIDRYLAVVHAVFALKARTVTFGVVTSVITWVVAVFASLPGIIFTRSQKEGLHYTCSSHFPYSQYQFWKNFQTLKIVILGLVLPLLVMVICYSGILKTLLRCRNEKKRHRAVRLIFTIMIVYFLFWAPYNIVLLLNTFQEFFGLNNCSSSNRLDQAMQVTETLGMTHCCINPIIYAFVGEKFRNYLLVFFQKHIAKRFCKCCSIFQQEAPERASSVYTRSTGEQEISVGL DIP protein P51681 original sequence version: 108 DIP protein P51681 original sequence version: 130 88ECE1F38E6D45A7 luke-ccr5-1 1 4 unspecified role unspecified role prey prey HA-tag HA-tag ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range human Homo sapiens Human 3 unspecified role unspecified role bait bait His-tag His-tag his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range Mature protein Region 29-314 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain ecolx Escherichia coli physical association physical association ccr5-luke-1 2 4 unspecified role unspecified role bait bait canlf Canis familiaris (dog) Canis lupus familiaris Dog Canis familiaris 3 unspecified role unspecified role prey prey Mature protein Region 29-314 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain ecolx Escherichia coli direct interaction direct interaction