DIP Database of Interacting Proteins 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ dip@mbi.ucla.edu MYBL2 is a substrate of GSK3-like kinase BIN2 and acts as a corepressor of BES1 in brassinosteroid signaling pathway in Arabidopsis. MYBL2 is a substrate of GSK3-like kinase BIN2 and acts as a corepressor of BES1 in brassinosteroid signaling pathway in Arabidopsis. Proceedings of the National Academy of Sciences of the United States of America 2012 imex curation Ye H., Li L., Guo H., Yin Y. Only protein-protein interactions yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid predetermined predetermined participant predetermined Ye H., Li L., Guo H., Yin Y. DIP original experiment: DIP-251845X Proceedings of the National Academy of Sciences of the United States of America 2012 IMEx MYBL2 is a substrate of GSK3-like kinase BIN2 and acts as a corepressor of BES1 in brassinosteroid signaling pathway in Arabidopsis. MYBL2 is a substrate of GSK3-like kinase BIN2 and acts as a corepressor of BES1 in brassinosteroid signaling pathway in Arabidopsis. MYBL2 is a substrate of GSK3-like kinase BIN2 and acts as a corepressor of BES1 in brassinosteroid signaling pathway in Arabidopsis. Proceedings of the National Academy of Sciences of the United States of America 2012 imex curation Ye H., Li L., Guo H., Yin Y. Only protein-protein interactions in vitro In vitro pull down pull down predetermined predetermined participant predetermined Ye H., Li L., Guo H., Yin Y. DIP original experiment: DIP-251848X Proceedings of the National Academy of Sciences of the United States of America 2012 IMEx MYBL2 is a substrate of GSK3-like kinase BIN2 and acts as a corepressor of BES1 in brassinosteroid signaling pathway in Arabidopsis. MYBL2 is a substrate of GSK3-like kinase BIN2 and acts as a corepressor of BES1 in brassinosteroid signaling pathway in Arabidopsis. MYBL2 is a substrate of GSK3-like kinase BIN2 and acts as a corepressor of BES1 in brassinosteroid signaling pathway in Arabidopsis. Proceedings of the National Academy of Sciences of the United States of America 2012 imex curation Ye H., Li L., Guo H., Yin Y. Only protein-protein interactions in vitro In vitro protein kinase assay protein kinase assay predetermined predetermined participant predetermined Ye H., Li L., Guo H., Yin Y. DIP original experiment: DIP-251849X Proceedings of the National Academy of Sciences of the United States of America 2012 IMEx MYBL2 is a substrate of GSK3-like kinase BIN2 and acts as a corepressor of BES1 in brassinosteroid signaling pathway in Arabidopsis. MYBL2 is a substrate of GSK3-like kinase BIN2 and acts as a corepressor of BES1 in brassinosteroid signaling pathway in Arabidopsis. MYBL2 is a substrate of GSK3-like kinase BIN2 and acts as a corepressor of BES1 in brassinosteroid signaling pathway in Arabidopsis. Proceedings of the National Academy of Sciences of the United States of America 2012 imex curation Ye H., Li L., Guo H., Yin Y. Only protein-protein interactions in vitro In vitro protein kinase assay protein kinase assay weight autoradiogra molecular weight estimation by autoradiography weight autoradiogra Ye H., Li L., Guo H., Yin Y. DIP original experiment: DIP-251850X Proceedings of the National Academy of Sciences of the United States of America 2012 IMEx MYBL2 is a substrate of GSK3-like kinase BIN2 and acts as a corepressor of BES1 in brassinosteroid signaling pathway in Arabidopsis. MYBL2 is a substrate of GSK3-like kinase BIN2 and acts as a corepressor of BES1 in brassinosteroid signaling pathway in Arabidopsis. MYBL2 is a substrate of GSK3-like kinase BIN2 and acts as a corepressor of BES1 in brassinosteroid signaling pathway in Arabidopsis. Proceedings of the National Academy of Sciences of the United States of America 2012 imex curation Ye H., Li L., Guo H., Yin Y. Only protein-protein interactions in vitro In vitro pull down pull down anti tag western anti tag western blot anti tag western Ye H., Li L., Guo H., Yin Y. DIP original experiment: DIP-251847X Proceedings of the National Academy of Sciences of the United States of America 2012 IMEx MYBL2 is a substrate of GSK3-like kinase BIN2 and acts as a corepressor of BES1 in brassinosteroid signaling pathway in Arabidopsis. MYBL2 is a substrate of GSK3-like kinase BIN2 and acts as a corepressor of BES1 in brassinosteroid signaling pathway in Arabidopsis. MYBL2 is a substrate of GSK3-like kinase BIN2 and acts as a corepressor of BES1 in brassinosteroid signaling pathway in Arabidopsis. Proceedings of the National Academy of Sciences of the United States of America 2012 imex curation Ye H., Li L., Guo H., Yin Y. Only protein-protein interactions arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress bifc bimolecular fluorescence complementation bifc predetermined predetermined participant predetermined Ye H., Li L., Guo H., Yin Y. DIP original experiment: DIP-251846X Proceedings of the National Academy of Sciences of the United States of America 2012 IMEx MYBL2 is a substrate of GSK3-like kinase BIN2 and acts as a corepressor of BES1 in brassinosteroid signaling pathway in Arabidopsis. MYBL2 is a substrate of GSK3-like kinase BIN2 and acts as a corepressor of BES1 in brassinosteroid signaling pathway in Arabidopsis. MYBL2 is a substrate of GSK3-like kinase BIN2 and acts as a corepressor of BES1 in brassinosteroid signaling pathway in Arabidopsis. Proceedings of the National Academy of Sciences of the United States of America 2012 imex curation Ye H., Li L., Guo H., Yin Y. Only protein-protein interactions yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid predetermined predetermined participant predetermined Ye H., Li L., Guo H., Yin Y. DIP original experiment: DIP-251844X Proceedings of the National Academy of Sciences of the United States of America 2012 IMEx MYBL2 is a substrate of GSK3-like kinase BIN2 and acts as a corepressor of BES1 in brassinosteroid signaling pathway in Arabidopsis. MYBL2 is a substrate of GSK3-like kinase BIN2 and acts as a corepressor of BES1 in brassinosteroid signaling pathway in Arabidopsis. MYBL2 is a substrate of GSK3-like kinase BIN2 and acts as a corepressor of BES1 in brassinosteroid signaling pathway in Arabidopsis. Proceedings of the National Academy of Sciences of the United States of America 2012 imex curation Ye H., Li L., Guo H., Yin Y. Only protein-protein interactions in vitro In vitro pull down pull down predetermined predetermined participant predetermined Ye H., Li L., Guo H., Yin Y. DIP original experiment: DIP-251851X Proceedings of the National Academy of Sciences of the United States of America 2012 IMEx MYBL2 is a substrate of GSK3-like kinase BIN2 and acts as a corepressor of BES1 in brassinosteroid signaling pathway in Arabidopsis. ksg7_arath Shaggy-related protein kinase eta ASK7 BIN2 DWF12 UCU1 ASK-eta Protein BRASSINOSTEROID INSENSITIVE 2 Protein ULTRACURVATA 1 F28A21.120 At4g18710 SK21 Shaggy-related protein kinase 21 protein protein arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress MADDKEMPAAVVDGHDQVTGHIISTTIGGKNGEPKQTISYMAERVVGTGSFGIVFQAKCLETGETVAIKKVLQDRRYKNRELQLMRVMDHPNVVCLKHCFFSTTSKDELFLNLVMEYVPESLYRVLKHYSSANQRMPLVYVKLYMYQIFRGLAYIHNVAGVCHRDLKPQNLLVDPLTHQVKICDFGSAKQLVKGEANISYICSRFYRAPELIFGATEYTTSIDIWSAGCVLAELLLGQPLFPGENAVDQLVEIIKVLGTPTREEIRCMNPHYTDFRFPQIKAHPWHKIFHKRMPPEAIDFASRLLQYSPSLRCTALEACAHPFFDELREPNARLPNGRPFPPLFNFKQEVAGSSPELVNKLIPDHIKRQLGLSFLNQSGT DIP protein Q39011 original sequence version: 100 DIP protein Q39011 original sequence version: 121 DIP protein Q39011 original sequence version: 146 DIP protein Q39011 original sequence version: 129 DIP protein Q39011 original sequence version: 113 86C2FD5F77201168 q9c9a5_arath ARABIDOPSIS MYB-LIKE 2 ATMYBL2 MYB-like 2 MYBL2 F23N20.2 F23N20_2 At1g71030 protein protein arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress MNKTRLRALSPPSGMQHRKRCRLRGRNYVRPEVKQRNFSKDEDDLILKLHALLGNRWSLIAGRLPGRTDNEVRIHWETYLKRKLVKMGIDPTNHRLHHHTNYISRRHLHSSHKEHETKIISDQSSSVSESCGVTILPIPSTNCSEDSTSTGRSHLPDLNIGLIPAVTSLPALCLQDSSESSTNGSTGQETLLLFR DIP protein Q9C9A5 original sequence version: 94 B270E3414A015967 bzr2_arath Protein BRASSINAZOLE-RESISTANT 2 BZR2 BES1 BIS1 At1g19350 F18O14_4 Protein BRI1-EMS-SUPPRESSOR 1 Protein BIN2 SUBSTRATE 1 Protein 107 protein protein arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress MTSDGATSTSAAAAAAAMATRRKPSWRERENNRRRERRRRAVAAKIYTGLRAQGNYNLPKHCDNNEVLKALCSEAGWVVEEDGTTYRKGHKPLPGDMAGSSSRATPYSSHNQSPLSSTFDSPILSYQVSPSSSSFPSPSRVGDPHNISTIFPFLRNGGIPSSLPPLRISNSAPVTPPVSSPTSRNPKPLPTWESFTKQSMSMAAKQSMTSLNYPFYAVSAPASPTHHRQFHAPATIPECDESDSSTVDSGHWISFQKFAQQQPFSASMVPTSPTFNLVKPAPQQLSPNTAAIQEIGQSSEFKFENSQVKPWEGERIHDVAMEDLELTLGNGKAHS DIP protein Q9LN63 original sequence version: 82 DIP protein Q9LN63 original sequence version: 47 DIP protein Q9LN63 original sequence version: 60 DIP protein Q9LN63 original sequence version: 79 DIP protein Q9LN63 original sequence version: 99 7B0AA929FED4748B bzr2-f23n20.2-1 6 11 unspecified role unspecified role unspecified role unspecified role cYFP-tag cYFP-tag cyfp cYFP c-term range C-terminal range c-term range c-term range C-terminal range c-term range arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress 10 unspecified role unspecified role unspecified role unspecified role nYFP-tag nYFP-tag nyfp nYFP c-term range C-terminal range c-term range c-term range C-terminal range c-term range arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress physical association physical association bzr2-f23n20.2-2 7 11 unspecified role unspecified role bait bait Region 89-140 Region 89-140 sufficient to bind sufficient binding region sufficient to bind deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 10 unspecified role unspecified role prey prey yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast direct interaction direct interaction bzr2-f23n20.2-3 8 11 unspecified role unspecified role bait bait GST-tag GST-tag gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range Region 89-335 Region 89-335 sufficient to bind sufficient binding region sufficient to bind deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain ecolx Escherichia coli 10 unspecified role unspecified role prey prey MBP-tag MBP-tag mbp tag maltose binding protein tag maltose binding protein tag maltose binding protein tag mbp tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range ecolx Escherichia coli direct interaction direct interaction ask7-f23n20.2-1 2 9 unspecified role unspecified role bait bait GST-tag GST-tag gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range ecolx Escherichia coli 10 unspecified role unspecified role prey prey MBP-tag MBP-tag mbp tag maltose binding protein tag maltose binding protein tag maltose binding protein tag mbp tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range ecolx Escherichia coli direct interaction direct interaction bzr2-f23n20.2-4 1 11 unspecified role unspecified role bait bait Region 89-140 Region 89-140 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 10 unspecified role unspecified role prey prey Region 34-82 Region 34-82 sufficient to bind sufficient binding region sufficient to bind deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast direct interaction direct interaction f23n20.2-bzr2-1 5 11 unspecified role unspecified role prey prey MBP-tag MBP-tag mbp tag maltose binding protein tag maltose binding protein tag maltose binding protein tag mbp tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range ecolx Escherichia coli 10 unspecified role unspecified role bait bait GST-tag GST-tag gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range ecolx Escherichia coli direct interaction direct interaction ask7-f23n20.2-2 3 9 enzyme enzyme unspecified role unspecified role ecolx Escherichia coli 10 enzyme target enzyme target substrate substrate unspecified role unspecified role ecolx Escherichia coli phosphorylation phosphorylation reaction phosphorylation ask7-1 4 9 putative self putative self unspecified role unspecified role ecolx Escherichia coli phosphorylation phosphorylation reaction phosphorylation true