DIP Database of Interacting Proteins 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ dip@mbi.ucla.edu A Rab32-dependent pathway contributes to Salmonella typhi host restriction. A Rab32-dependent pathway contributes to Salmonella typhi host restriction. Science (New York, N.Y.) 2012 imex curation Spanò S., Galán JE. Only protein-protein interactions in vitro In vitro protease assay protease assay weight by comassie molecular weight estimation by coomasie staining weight by comassie Spanò S., Galán JE. DIP original experiment: DIP-268241X Science (New York, N.Y.) 2012 IMEx A Rab32-dependent pathway contributes to Salmonella typhi host restriction. A Rab32-dependent pathway contributes to Salmonella typhi host restriction. A Rab32-dependent pathway contributes to Salmonella typhi host restriction. Science (New York, N.Y.) 2012 imex curation Spanò S., Galán JE. Only protein-protein interactions in vitro In vitro protease assay protease assay weight by comassie molecular weight estimation by coomasie staining weight by comassie Spanò S., Galán JE. DIP original experiment: DIP-268242X Science (New York, N.Y.) 2012 IMEx A Rab32-dependent pathway contributes to Salmonella typhi host restriction. rab38_human Ras-related protein Rab-38 RAB38 Melanoma antigen NY-MEL-1 protein protein human Homo sapiens Human MQAPHKEHLYKLLVIGDLGVGKTSIIKRYVHQNFSSHYRATIGVDFALKVLHWDPETVVRLQLWDIAGQERFGNMTRVYYREAMGAFIVFDVTRPATFEAVAKWKNDLDSKLSLPNGKPVSVVLLANKCDQGKDVLMNNGLKMDQFCKEHGFVGWFETSAKENINIDEASRCLVKHILANECDLMESIEPDVVKPHLTSTKVASCSGCAKS DIP protein P57729 original sequence version: 119 DIP protein P57729 original sequence version: 140 0D16B42A1B237539 h9l447_salty STM1055 protein protein salty Salmonella typhimurium MLRHIQNSLGSVYRSNTATPQGQIIHHRNFQSQFDTTGNTLYNNCWVCSLNVIKSRDGNNYSALEDITSDNQAFNNILEGIDIIECENLLKEMNVQKIPESSLFTNIKEALQAEVFNSTVEDDFESFISYELQNHGPLMLIRPSLGSECLHAECIVGYDSEVKKVLIYDSMNTSPEWQSNIDVYDKLTLAFNDKYKNEDCSICGLYYDGVYEPKPLHSSSWKDWCTIL DIP protein H9L447 original sequence version: 20 DIP protein H9L447 original sequence version: 5 rab32_human Ras-related protein Rab-32 RAB32 protein protein human Homo sapiens Human MAGGGAGDPGLGAAAAPAPETREHLFKVLVIGELGVGKTSIIKRYVHQLFSQHYRATIGVDFALKVLNWDSRTLVRLQLWDIAGQERFGNMTRVYYKEAVGAFVVFDISRSSTFEAVLKWKSDLDSKVHLPNGSPIPAVLLANKCDQNKDSSQSPSQVDQFCKEHGFAGWFETSAKDNINIEEAARFLVEKILVNHQSFPNEENDVDKIKLDQETLRAENKSQCC DIP protein Q13637 original sequence version: 145 91D41BAC1E3434CA h9l447_salty-rab32-1 1 5 enzyme target enzyme target substrate substrate unspecified role unspecified role ecolx Escherichia coli 4 enzyme enzyme unspecified role unspecified role ecolx Escherichia coli protein cleavage protein cleavage h9l447_salty-rab38-1 2 3 enzyme target enzyme target substrate substrate unspecified role unspecified role ecolx Escherichia coli 4 enzyme enzyme unspecified role unspecified role ecolx Escherichia coli protein cleavage protein cleavage