DIP Database of Interacting Proteins 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ dip@mbi.ucla.edu X-ray structure of the Yersinia pestis heme transporter HmuUV. X-ray structure of the Yersinia pestis heme transporter HmuUV. Nature structural & molecular biology 2012 imex curation Woo JS., Zeltina A., Goetz BA., Locher KP. Only protein-protein interactions ecolx Escherichia coli molecular sieving molecular sieving Gel Filtration Size Exclusion Chromatography Size Exclusion Chromatography Gel Filtration Sizing column predetermined predetermined participant predetermined Woo JS., Zeltina A., Goetz BA., Locher KP. DIP original experiment: DIP-251440X Nature structural & molecular biology 2012 IMEx X-ray structure of the Yersinia pestis heme transporter HmuUV. X-ray structure of the Yersinia pestis heme transporter HmuUV. X-ray structure of the Yersinia pestis heme transporter HmuUV. Nature structural & molecular biology 2012 imex curation Woo JS., Zeltina A., Goetz BA., Locher KP. Only protein-protein interactions in vitro In vitro molecular sieving molecular sieving Gel Filtration Size Exclusion Chromatography Size Exclusion Chromatography Gel Filtration Sizing column predetermined predetermined participant predetermined Woo JS., Zeltina A., Goetz BA., Locher KP. DIP original experiment: DIP-251442X Nature structural & molecular biology 2012 IMEx X-ray structure of the Yersinia pestis heme transporter HmuUV. X-ray structure of the Yersinia pestis heme transporter HmuUV. X-ray structure of the Yersinia pestis heme transporter HmuUV. Nature structural & molecular biology 2012 imex curation Woo JS., Zeltina A., Goetz BA., Locher KP. Only protein-protein interactions ecolx Escherichia coli x-ray diffraction x-ray crystallography X-ray X-ray x-ray diffraction predetermined predetermined participant predetermined Woo JS., Zeltina A., Goetz BA., Locher KP. DIP original experiment: DIP-251441X Nature structural & molecular biology 2012 IMEx X-ray structure of the Yersinia pestis heme transporter HmuUV. X-ray structure of the Yersinia pestis heme transporter HmuUV. X-ray structure of the Yersinia pestis heme transporter HmuUV. Nature structural & molecular biology 2012 imex curation Woo JS., Zeltina A., Goetz BA., Locher KP. Only protein-protein interactions ecolx Escherichia coli pull down pull down predetermined predetermined participant predetermined Woo JS., Zeltina A., Goetz BA., Locher KP. DIP original experiment: DIP-251443X Nature structural & molecular biology 2012 IMEx X-ray structure of the Yersinia pestis heme transporter HmuUV. hmut_yerpe Hemin-binding periplasmic protein HmuT hmuT YPO0281 y0541 YP_0436 protein protein yerpe Yersinia pestis MRLRLLSLPFILSLCAPLLPLNTLAAERIVTIGGDVTEIAYALGAGDEIVARDSTSQQPQAAQKLPDVGYMRTLNAEGILAMKPTMLLVSELAQPSLVLTQIASSGVNVVTVPGQTTPESVAMKINAVATALHQTEKGQKLIEDYQQRLAAVNKTPLPVKVLFVMSHGGLTPMAAGQNTAADAMIRAAGGSNAMQGFSRYRPLSQEGVIASAPDLLLITTDGVKALGSSENIWKLPGMALTPAGKHKRLLVVDDMALLGFGLETPQVLAQLREKMEQMQ DIP protein Q56991 original sequence version: 94 190547D960C93763 hmuu_yerpe Hemin transport system permease protein HmuU hmuU YPO0280 y0540 YP_0435 protein protein yerpe Yersinia pestis MNGRVQPRLMLGFLLILLVILALGSANMGALSLSFRTLWNTSTNDAMWHIWLNIRLPRVLLAVVVGCALAVSGTIMQGLFRNPLADPGLLGISSGAALCVGLIIVMPFSLPPLLALYSHMVGAFIGSLAISTIIFTLSRWGHGNLARLLLAGIAINALCGAAVGVLTYISDDQQLRQFSLWSMGSLGQAQWSTLLVASSLILPTCILGLLQARQLNLLQLGDEEAHYLGVNVRQAKLRLLLLSAILIGAAVAVSGVIGFIGLVVPHLIRMRIGADHRWLLPGAALGGACLLLTADTLARTLVAPAEMPVGLLTSLLGGPYFLWLILRQREQRSG DIP protein Q56992 original sequence version: 93 hmuv_yerpe Hemin import ATP-binding protein HmuV hmuV YPO0279 y0539 YP_0434 protein protein yerpe Yersinia pestis MVDMAVTPVALLEASHLHYHVQQQALINDVSLHIASGEMVAIIGPNGAGKSTLLRLLTGYLSPSHGECHLLGQNLNSWQPKALARTRAVMRQYSELAFPFSVSEVIQMGRAPYGGSQDRQALQQVMAQTDCLALAQRDYRVLSGGEQQRVQLARVLAQLWQPQPTPRWLFLDEPTSALDLYHQQHTLRLLRQLTRQEPLAVCCVLHDLNLAALYADRIMLLAQGKLVACGTPEEVLNAETLTQWYQADLGVSRHPESALPQIYLRQ DIP protein Q56993 original sequence version: 104 4A7DEB955583CB27 hmuu-hmuv-1 1 7 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli 6 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli direct interaction direct interaction hmuu-hmuv-2 4 7 unspecified role unspecified role prey prey ecolx Escherichia coli 6 unspecified role unspecified role bait bait His-tag His-tag his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range ecolx Escherichia coli physical association physical association hmuu-hmuv-3 3 7 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli 6 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli direct interaction direct interaction hmut-hmuu-1 2 5 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli 7 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli 6 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli physical association physical association