DIP Database of Interacting Proteins 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ dip@mbi.ucla.edu Noncanonical E2 recruitment by the autophagy E1 revealed by Atg7-Atg3 and Atg7-Atg10 structures. Noncanonical E2 recruitment by the autophagy E1 revealed by Atg7-Atg3 and Atg7-Atg10 structures. Nature structural & molecular biology 2012 imex curation Kaiser SE., Mao K., Taherbhoy AM., Yu S., Olszewski JL., Duda DM., Kurinov I., Deng A., Fenn TD., Klionsky DJ., Schulman BA. Only protein-protein interactions in vitro In vitro crosslink cross-linking study crosslink predetermined predetermined participant predetermined Kaiser SE., Mao K., Taherbhoy AM., Yu S., Olszewski JL., Duda DM., Kurinov I., Deng A., Fenn TD., Klionsky DJ., Schulman BA. DIP original experiment: DIP-251412X Nature structural & molecular biology 2012 IMEx Noncanonical E2 recruitment by the autophagy E1 revealed by Atg7-Atg3 and Atg7-Atg10 structures. Noncanonical E2 recruitment by the autophagy E1 revealed by Atg7-Atg3 and Atg7-Atg10 structures. Noncanonical E2 recruitment by the autophagy E1 revealed by Atg7-Atg3 and Atg7-Atg10 structures. Nature structural & molecular biology 2012 imex curation Kaiser SE., Mao K., Taherbhoy AM., Yu S., Olszewski JL., Duda DM., Kurinov I., Deng A., Fenn TD., Klionsky DJ., Schulman BA. Only protein-protein interactions in vitro In vitro crosslink cross-linking study crosslink predetermined predetermined participant predetermined Kaiser SE., Mao K., Taherbhoy AM., Yu S., Olszewski JL., Duda DM., Kurinov I., Deng A., Fenn TD., Klionsky DJ., Schulman BA. DIP original experiment: DIP-251411X Nature structural & molecular biology 2012 IMEx Noncanonical E2 recruitment by the autophagy E1 revealed by Atg7-Atg3 and Atg7-Atg10 structures. Noncanonical E2 recruitment by the autophagy E1 revealed by Atg7-Atg3 and Atg7-Atg10 structures. Noncanonical E2 recruitment by the autophagy E1 revealed by Atg7-Atg3 and Atg7-Atg10 structures. Nature structural & molecular biology 2012 imex curation Kaiser SE., Mao K., Taherbhoy AM., Yu S., Olszewski JL., Duda DM., Kurinov I., Deng A., Fenn TD., Klionsky DJ., Schulman BA. Only protein-protein interactions in vitro In vitro crosslink cross-linking study crosslink predetermined predetermined participant predetermined Kaiser SE., Mao K., Taherbhoy AM., Yu S., Olszewski JL., Duda DM., Kurinov I., Deng A., Fenn TD., Klionsky DJ., Schulman BA. DIP original experiment: DIP-251413X Nature structural & molecular biology 2012 IMEx Noncanonical E2 recruitment by the autophagy E1 revealed by Atg7-Atg3 and Atg7-Atg10 structures. Noncanonical E2 recruitment by the autophagy E1 revealed by Atg7-Atg3 and Atg7-Atg10 structures. Noncanonical E2 recruitment by the autophagy E1 revealed by Atg7-Atg3 and Atg7-Atg10 structures. Nature structural & molecular biology 2012 imex curation Kaiser SE., Mao K., Taherbhoy AM., Yu S., Olszewski JL., Duda DM., Kurinov I., Deng A., Fenn TD., Klionsky DJ., Schulman BA. Only protein-protein interactions in vitro In vitro comigration in sds comigration in sds page comigration in sds predetermined predetermined participant predetermined Kaiser SE., Mao K., Taherbhoy AM., Yu S., Olszewski JL., Duda DM., Kurinov I., Deng A., Fenn TD., Klionsky DJ., Schulman BA. DIP original experiment: DIP-251408X Nature structural & molecular biology 2012 IMEx Noncanonical E2 recruitment by the autophagy E1 revealed by Atg7-Atg3 and Atg7-Atg10 structures. Noncanonical E2 recruitment by the autophagy E1 revealed by Atg7-Atg3 and Atg7-Atg10 structures. Noncanonical E2 recruitment by the autophagy E1 revealed by Atg7-Atg3 and Atg7-Atg10 structures. Nature structural & molecular biology 2012 imex curation Kaiser SE., Mao K., Taherbhoy AM., Yu S., Olszewski JL., Duda DM., Kurinov I., Deng A., Fenn TD., Klionsky DJ., Schulman BA. Only protein-protein interactions in vitro In vitro crosslink cross-linking study crosslink predetermined predetermined participant predetermined Kaiser SE., Mao K., Taherbhoy AM., Yu S., Olszewski JL., Duda DM., Kurinov I., Deng A., Fenn TD., Klionsky DJ., Schulman BA. DIP original experiment: DIP-251407X Nature structural & molecular biology 2012 IMEx Noncanonical E2 recruitment by the autophagy E1 revealed by Atg7-Atg3 and Atg7-Atg10 structures. Noncanonical E2 recruitment by the autophagy E1 revealed by Atg7-Atg3 and Atg7-Atg10 structures. Noncanonical E2 recruitment by the autophagy E1 revealed by Atg7-Atg3 and Atg7-Atg10 structures. Nature structural & molecular biology 2012 imex curation Kaiser SE., Mao K., Taherbhoy AM., Yu S., Olszewski JL., Duda DM., Kurinov I., Deng A., Fenn TD., Klionsky DJ., Schulman BA. Only protein-protein interactions in vitro In vitro crosslink cross-linking study crosslink predetermined predetermined participant predetermined Kaiser SE., Mao K., Taherbhoy AM., Yu S., Olszewski JL., Duda DM., Kurinov I., Deng A., Fenn TD., Klionsky DJ., Schulman BA. DIP original experiment: DIP-251406X Nature structural & molecular biology 2012 IMEx Noncanonical E2 recruitment by the autophagy E1 revealed by Atg7-Atg3 and Atg7-Atg10 structures. Noncanonical E2 recruitment by the autophagy E1 revealed by Atg7-Atg3 and Atg7-Atg10 structures. Noncanonical E2 recruitment by the autophagy E1 revealed by Atg7-Atg3 and Atg7-Atg10 structures. Nature structural & molecular biology 2012 imex curation Kaiser SE., Mao K., Taherbhoy AM., Yu S., Olszewski JL., Duda DM., Kurinov I., Deng A., Fenn TD., Klionsky DJ., Schulman BA. Only protein-protein interactions in vitro In vitro comigration in sds comigration in sds page comigration in sds predetermined predetermined participant predetermined Kaiser SE., Mao K., Taherbhoy AM., Yu S., Olszewski JL., Duda DM., Kurinov I., Deng A., Fenn TD., Klionsky DJ., Schulman BA. DIP original experiment: DIP-251409X Nature structural & molecular biology 2012 IMEx Noncanonical E2 recruitment by the autophagy E1 revealed by Atg7-Atg3 and Atg7-Atg10 structures. Noncanonical E2 recruitment by the autophagy E1 revealed by Atg7-Atg3 and Atg7-Atg10 structures. Noncanonical E2 recruitment by the autophagy E1 revealed by Atg7-Atg3 and Atg7-Atg10 structures. Nature structural & molecular biology 2012 imex curation Kaiser SE., Mao K., Taherbhoy AM., Yu S., Olszewski JL., Duda DM., Kurinov I., Deng A., Fenn TD., Klionsky DJ., Schulman BA. Only protein-protein interactions in vitro In vitro comigration in sds comigration in sds page comigration in sds predetermined predetermined participant predetermined Kaiser SE., Mao K., Taherbhoy AM., Yu S., Olszewski JL., Duda DM., Kurinov I., Deng A., Fenn TD., Klionsky DJ., Schulman BA. DIP original experiment: DIP-251410X Nature structural & molecular biology 2012 IMEx Noncanonical E2 recruitment by the autophagy E1 revealed by Atg7-Atg3 and Atg7-Atg10 structures. atg3_yeast Autophagy-related protein 3 Autophagy-related E2-like conjugation enzyme ATG3 ATG3 AUT1 YNR007C N2040 APG3 protein protein yeast Saccharomyces cerevisiae Baker's yeast MIRSTLSSWREYLTPITHKSTFLTTGQITPEEFVQAGDYLCHMFPTWKWNEESSDISYRDFLPKNKQFLIIRKVPCDKRAEQCVEVEGPDVIMKGFAEDGDEDDVLEYIGSETEHVQSTPAGGTKDSSIDDIDELIQDMEIKEEDENDDTEEFNAKGGLAKDMAQERYYDLYIAYSTSYRVPKMYIVGFNSNGSPLSPEQMFEDISADYRTKTATIEKLPFYKNSVLSVSIHPCKHANVMKILLDKVRVVRQRRRKELQEEQELDGVGDWEDLQDDIDDSLRVDQYLIVFLKFITSVTPSIQHDYTMEGW 52CCFB216B18CF0C 52CCFB216B18CF0C atg8_yeast Autophagy-related protein 8 ATG8 APG8 AUT7 YBL078C YBL0732 CVT5 Autophagy-related ubiquitin-like modifier ATG8 Cytoplasm to vacuole targeting protein 5 protein protein yeast Saccharomyces cerevisiae Baker's yeast MKSTFKSEYPFEKRKAESERIADRFKNRIPVICEKAEKSDIPEIDKRKYLVPADLTVGQFVYVIRKRIMLPPEKAIFIFVNDTLPPTAALMSAIYQEHKDKDGFLYVTYSGENTFGR 1246CEFF5A038819 1246CEFF5A038819 atg7_yeast Ubiquitin-like modifier-activating enzyme ATG7 ATG7 APG7 CVT2 ATG12-activating enzyme E1 ATG7 Cytoplasm to vacuole targeting protein 2 Autophagy-related protein 7 YHR171W protein protein yeast Saccharomyces cerevisiae Baker's yeast MSSERVLSYAPAFKSFLDTSFFQELSRLKLDVLKLDSTCQPLTVNLDLHNIPKSADQVPLFLTNRSFEKHNNKRTNEVPLQGSIFNFNVLDEFKNLDKQLFLHQRALECWEDGIKDINKCVSFVIISFADLKKYRFYYWLGVPCFQRPSSTVLHVRPEPSLKGLFSKCQKWFDVNYSKWVCILDADDEIVNYDKCIIRKTKVLAIRDTSTMENVPSALTKNFLSVLQYDVPDLIDFKLLIIRQNEGSFALNATFASIDPQSSSSNPDMKVSGWERNVQGKLAPRVVDLSSLLDPLKIADQSVDLNLKLMKWRILPDLNLDIIKNTKVLLLGAGTLGCYVSRALIAWGVRKITFVDNGTVSYSNPVRQALYNFEDCGKPKAELAAASLKRIFPLMDATGVKLSIPMIGHKLVNEEAQHKDFDRLRALIKEHDIIFLLVDSRESRWLPSLLSNIENKTVINAALGFDSYLVMRHGNRDEQSSKQLGCYFCHDVVAPTDSLTDRTLDQMCTVTRPGVAMMASSLAVELMTSLLQTKYSGSETTVLGDIPHQIRGFLHNFSILKLETPAYEHCPACSPKVIEAFTDLGWEFVKKALEHPLYLEEISGLSVIKQEVERLGNDVFEWEDDESDEIA 561EEC94F0ED57F5 561EEC94F0ED57F5 atg10_yeast Ubiquitin-like-conjugating enzyme ATG10 Autophagy-related protein 10 ATG10 YLL042C APG10 protein protein yeast Saccharomyces cerevisiae Baker's yeast MIPYQEWHSQLQSLYDSQIFHNWALCQDVHLNDEKDGLLLRLIPTRQLQKNTERIENKLLNHIELYLTYSKVYNEPLLLLRIWEEKSIDGIPMTKLMLPTDIESLLDVQGKFQLGLDTIINLEGSVWYSFHPCDTSCIVGDQAEFMSTYLRRWVSIFIFSWLGYEDS 9B90684B8D3D26C5 9B90684B8D3D26C5 atg3-atg8-3 4 10 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli 9 unspecified role unspecified role unspecified role unspecified role P40344:p.[Arg72Ala;Lys73Ala;Tyr168Ala] R72A/K73A/Y168A mutation disrupting strength mutation disrupting interaction strength mutation disrupting strength alanine scanning alanine scanning certain certain sequence position certain certain certain sequence position certain K A certain certain sequence position certain certain certain sequence position certain R A certain certain sequence position certain certain certain sequence position certain Y A This feature has been corrected as a result of our quality control procedures. The original label was 'R72A/K73A/Y168A'. Wed May 02 14:53:56 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'arg72ala,lys73ala,tyr168ala' Tue Jun 30 19:39:01 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.[Arg72Ala;Lys73Ala;Tyr168Ala]' ecolx Escherichia coli covalent binding covalent binding atg10-atg7-2 1 12 unspecified role unspecified role unspecified role unspecified role Q07879:p.[Cys26Ala;Cys137Ala] C26A/C137A mutation mutation certain certain sequence position certain certain certain sequence position certain C A certain certain sequence position certain certain certain sequence position certain C A This feature has been corrected as a result of our quality control procedures. The original label was 'C26A/C137A'. Wed May 02 19:03:24 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'cys26ala,cys137ala' Tue Jun 30 15:40:55 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.[Cys26Ala;Cys137Ala]' ecolx Escherichia coli 11 unspecified role unspecified role unspecified role unspecified role P38862:p.Leu291_Leu292insGlyGlySerGly GGSG-Ins mutation decreasing strength mutation decreasing interaction strength mutation decreasing strength insertion analysis insertion analysis certain certain sequence position certain certain certain sequence position certain LL LGGSGL Wed May 02 17:27:24 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'leu_leu291-292leu_gly_gly_ser_gly_leu' Tue Jun 30 18:27:19 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Leu291_Leu292insGlyGlySerGly' Region 290-294 Region 290-294 required to bind necessary binding region required to bind deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain P38862:p.Cys507Ala C507A mutation disrupting strength mutation disrupting interaction strength mutation disrupting strength alanine scanning alanine scanning certain certain sequence position certain certain certain sequence position certain C A This feature has been corrected as a result of our quality control procedures. The original label was 'C507A'. Wed May 02 17:32:21 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'cys507ala' Tue Jun 30 16:20:48 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Cys507Ala' P38862:p.Val285Asp V285D mutation disrupting strength mutation disrupting interaction strength mutation disrupting strength substitut analysis substitution analysis substitut analysis certain certain sequence position certain certain certain sequence position certain V D This feature has been corrected as a result of our quality control procedures. The original label was 'V285D'. Wed May 02 15:55:44 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'val285asp' Tue Jun 30 19:05:53 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Val285Asp' P38862:p.Tyr137Ala Y137A mutation decreasing strength mutation decreasing interaction strength mutation decreasing strength alanine scanning alanine scanning certain certain sequence position certain certain certain sequence position certain Y A This feature has been corrected as a result of our quality control procedures. The original label was 'Y137A'. Wed May 02 20:17:25 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'tyr137ala' Tue Jun 30 18:47:36 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Tyr137Ala' ecolx Escherichia coli direct interaction direct interaction atg3-atg7-1 6 9 unspecified role unspecified role unspecified role unspecified role P40344:p.[Cys41Ala;Cys76Ala;Cys83Ala] C41A/C76A/C83A mutation mutation certain certain sequence position certain certain certain sequence position certain C A certain certain sequence position certain certain certain sequence position certain C A certain certain sequence position certain certain certain sequence position certain C A This feature has been corrected as a result of our quality control procedures. The original label was 'C41A/C76A/C83A'. Wed May 02 18:14:19 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'cys41ala,cys76ala,cys83ala' Tue Jun 30 19:31:57 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.[Cys41Ala;Cys76Ala;Cys83Ala]' ecolx Escherichia coli 11 unspecified role unspecified role unspecified role unspecified role Region 289-630 Region 289-630 binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain ecolx Escherichia coli direct interaction direct interaction atg3-atg7-8 2 9 unspecified role unspecified role unspecified role unspecified role P40344:p.[Cys41Ala;Cys76Ala;Cys83Ala] C41A/C76A/C83A mutation mutation certain certain sequence position certain certain certain sequence position certain C A certain certain sequence position certain certain certain sequence position certain C A certain certain sequence position certain certain certain sequence position certain C A This feature has been corrected as a result of our quality control procedures. The original label was 'C41A/C76A/C83A'. Wed May 02 20:20:40 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'cys41ala,cys76ala,cys83ala' Tue Jun 30 17:12:38 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.[Cys41Ala;Cys76Ala;Cys83Ala]' ecolx Escherichia coli 11 unspecified role unspecified role unspecified role unspecified role P38862:p.Cys507Ala C507A mutation disrupting strength mutation disrupting interaction strength mutation disrupting strength alanine scanning alanine scanning certain certain sequence position certain certain certain sequence position certain C A This feature has been corrected as a result of our quality control procedures. The original label was 'C507A'. Wed May 02 15:34:51 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'cys507ala' Tue Jun 30 17:45:28 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Cys507Ala' P38862:p.Pro283Asp P283D mutation decreasing strength mutation decreasing interaction strength mutation decreasing strength substitut analysis substitution analysis substitut analysis certain certain sequence position certain certain certain sequence position certain P D This feature has been corrected as a result of our quality control procedures. The original label was 'P283D'. Wed May 02 18:50:22 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'pro283asp' Tue Jun 30 16:07:14 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Pro283Asp' P38862:p.Val285Ala V285A mutation decreasing strength mutation decreasing interaction strength mutation decreasing strength alanine scanning alanine scanning certain certain sequence position certain certain certain sequence position certain V A This feature has been corrected as a result of our quality control procedures. The original label was 'V285A'. Wed May 02 17:52:55 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'val285ala' Tue Jun 30 18:26:24 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Val285Ala' P38862:p.Leu291_Leu292insGlyGlySerGly GGSG-Ins mutation decreasing strength mutation decreasing interaction strength mutation decreasing strength insertion analysis insertion analysis certain certain sequence position certain certain certain sequence position certain LL LGGSGL Wed May 02 19:27:13 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'leu_leu291-292leu_gly_gly_ser_gly_leu' Tue Jun 30 16:54:00 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Leu291_Leu292insGlyGlySerGly' P38862:p.[Lys14Ala;Phe16Ala;Asp18Ala] K14A/F16A/D18A mutation decreasing strength mutation decreasing interaction strength mutation decreasing strength alanine scanning alanine scanning certain certain sequence position certain certain certain sequence position certain D A certain certain sequence position certain certain certain sequence position certain F A certain certain sequence position certain certain certain sequence position certain K A This feature has been corrected as a result of our quality control procedures. The original label was 'K14A/F16A/D18A'. Wed May 02 20:04:27 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'lys14ala,phe16ala,asp18ala' Tue Jun 30 19:43:27 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.[Lys14Ala;Phe16Ala;Asp18Ala]' P38862:p.[Phe16Ala;Phe61Ala] F16A/F61A mutation decreasing strength mutation decreasing interaction strength mutation decreasing strength alanine scanning alanine scanning certain certain sequence position certain certain certain sequence position certain F A certain certain sequence position certain certain certain sequence position certain F A This feature has been corrected as a result of our quality control procedures. The original label was 'F16A/F61A'. Wed May 02 18:35:46 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'phe16ala,phe61ala' Tue Jun 30 15:51:41 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.[Phe16Ala;Phe61Ala]' ecolx Escherichia coli direct interaction direct interaction Deletion of region 290-294 decreased the interaction rate/strength. atg7-atg8-1 7 11 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli 10 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli covalent binding covalent binding atg10-atg7-3 5 12 unspecified role unspecified role unspecified role unspecified role Q07879:p.[Cys26Ala;Cys137Ala] C26A/C137A mutation mutation certain certain sequence position certain certain certain sequence position certain C A certain certain sequence position certain certain certain sequence position certain C A This feature has been corrected as a result of our quality control procedures. The original label was 'C26A/C137A'. Wed May 02 20:07:17 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'cys26ala,cys137ala' Tue Jun 30 18:33:19 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.[Cys26Ala;Cys137Ala]' ecolx Escherichia coli 11 unspecified role unspecified role unspecified role unspecified role Region 289-630 Region 289-630 binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain ecolx Escherichia coli direct interaction direct interaction atg10-atg7-7 3 12 unspecified role unspecified role unspecified role unspecified role Q07879:p.[Cys26Ala;Cys137Ala] C26A/C137A mutation mutation certain certain sequence position certain certain certain sequence position certain C A certain certain sequence position certain certain certain sequence position certain C A This feature has been corrected as a result of our quality control procedures. The original label was 'C26A/C137A'. Wed May 02 14:47:20 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'cys26ala,cys137ala' Tue Jun 30 19:18:18 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.[Cys26Ala;Cys137Ala]' Region 86-93 Region 86-93 required to bind necessary binding region required to bind deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain ecolx Escherichia coli 11 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli direct interaction direct interaction atg10-atg8-1 8 12 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli 10 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli covalent binding covalent binding