DIP Database of Interacting Proteins 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ dip@mbi.ucla.edu The binding of Varp to VAMP7 traps VAMP7 in a closed, fusogenically inactive conformation. The binding of Varp to VAMP7 traps VAMP7 in a closed, fusogenically inactive conformation. Nature structural & molecular biology 2012 imex curation Schäfer IB., Hesketh GG., Bright NA., Gray SR., Pryor PR., Evans PR., Luzio JP., Owen DJ. Only protein-protein interactions in vitro In vitro molecular sieving molecular sieving Gel Filtration Size Exclusion Chromatography Size Exclusion Chromatography Gel Filtration Sizing column weight by comassie molecular weight estimation by coomasie staining weight by comassie Schäfer IB., Hesketh GG., Bright NA., Gray SR., Pryor PR., Evans PR., Luzio JP., Owen DJ. DIP original experiment: DIP-251383X Nature structural & molecular biology 2012 IMEx The binding of Varp to VAMP7 traps VAMP7 in a closed, fusogenically inactive conformation. The binding of Varp to VAMP7 traps VAMP7 in a closed, fusogenically inactive conformation. The binding of Varp to VAMP7 traps VAMP7 in a closed, fusogenically inactive conformation. Nature structural & molecular biology 2012 imex curation Schäfer IB., Hesketh GG., Bright NA., Gray SR., Pryor PR., Evans PR., Luzio JP., Owen DJ. Only protein-protein interactions yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence Schäfer IB., Hesketh GG., Bright NA., Gray SR., Pryor PR., Evans PR., Luzio JP., Owen DJ. DIP original experiment: DIP-251384X Nature structural & molecular biology 2012 IMEx The binding of Varp to VAMP7 traps VAMP7 in a closed, fusogenically inactive conformation. The binding of Varp to VAMP7 traps VAMP7 in a closed, fusogenically inactive conformation. The binding of Varp to VAMP7 traps VAMP7 in a closed, fusogenically inactive conformation. Nature structural & molecular biology 2012 imex curation Schäfer IB., Hesketh GG., Bright NA., Gray SR., Pryor PR., Evans PR., Luzio JP., Owen DJ. Only protein-protein interactions in vitro In vitro pull down pull down weight by comassie molecular weight estimation by coomasie staining weight by comassie Schäfer IB., Hesketh GG., Bright NA., Gray SR., Pryor PR., Evans PR., Luzio JP., Owen DJ. DIP original experiment: DIP-251401X Nature structural & molecular biology 2012 IMEx The binding of Varp to VAMP7 traps VAMP7 in a closed, fusogenically inactive conformation. The binding of Varp to VAMP7 traps VAMP7 in a closed, fusogenically inactive conformation. The binding of Varp to VAMP7 traps VAMP7 in a closed, fusogenically inactive conformation. Nature structural & molecular biology 2012 imex curation Schäfer IB., Hesketh GG., Bright NA., Gray SR., Pryor PR., Evans PR., Luzio JP., Owen DJ. Only protein-protein interactions in vitro In vitro pull down pull down anti tag western anti tag western blot anti tag western Schäfer IB., Hesketh GG., Bright NA., Gray SR., Pryor PR., Evans PR., Luzio JP., Owen DJ. DIP original experiment: DIP-251393X Nature structural & molecular biology 2012 IMEx The binding of Varp to VAMP7 traps VAMP7 in a closed, fusogenically inactive conformation. The binding of Varp to VAMP7 traps VAMP7 in a closed, fusogenically inactive conformation. The binding of Varp to VAMP7 traps VAMP7 in a closed, fusogenically inactive conformation. Nature structural & molecular biology 2012 imex curation Schäfer IB., Hesketh GG., Bright NA., Gray SR., Pryor PR., Evans PR., Luzio JP., Owen DJ. Only protein-protein interactions yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence Schäfer IB., Hesketh GG., Bright NA., Gray SR., Pryor PR., Evans PR., Luzio JP., Owen DJ. DIP original experiment: DIP-251386X Nature structural & molecular biology 2012 IMEx The binding of Varp to VAMP7 traps VAMP7 in a closed, fusogenically inactive conformation. The binding of Varp to VAMP7 traps VAMP7 in a closed, fusogenically inactive conformation. The binding of Varp to VAMP7 traps VAMP7 in a closed, fusogenically inactive conformation. Nature structural & molecular biology 2012 imex curation Schäfer IB., Hesketh GG., Bright NA., Gray SR., Pryor PR., Evans PR., Luzio JP., Owen DJ. Only protein-protein interactions yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid predetermined predetermined participant predetermined Schäfer IB., Hesketh GG., Bright NA., Gray SR., Pryor PR., Evans PR., Luzio JP., Owen DJ. DIP original experiment: DIP-251389X Nature structural & molecular biology 2012 IMEx The binding of Varp to VAMP7 traps VAMP7 in a closed, fusogenically inactive conformation. The binding of Varp to VAMP7 traps VAMP7 in a closed, fusogenically inactive conformation. The binding of Varp to VAMP7 traps VAMP7 in a closed, fusogenically inactive conformation. Nature structural & molecular biology 2012 imex curation Schäfer IB., Hesketh GG., Bright NA., Gray SR., Pryor PR., Evans PR., Luzio JP., Owen DJ. Only protein-protein interactions in vitro In vitro pull down pull down weight by comassie molecular weight estimation by coomasie staining weight by comassie Schäfer IB., Hesketh GG., Bright NA., Gray SR., Pryor PR., Evans PR., Luzio JP., Owen DJ. DIP original experiment: DIP-251395X Nature structural & molecular biology 2012 IMEx The binding of Varp to VAMP7 traps VAMP7 in a closed, fusogenically inactive conformation. The binding of Varp to VAMP7 traps VAMP7 in a closed, fusogenically inactive conformation. The binding of Varp to VAMP7 traps VAMP7 in a closed, fusogenically inactive conformation. Nature structural & molecular biology 2012 imex curation Schäfer IB., Hesketh GG., Bright NA., Gray SR., Pryor PR., Evans PR., Luzio JP., Owen DJ. Only protein-protein interactions in vitro In vitro itc isothermal titration calorimetry ITC ITC itc predetermined predetermined participant predetermined Schäfer IB., Hesketh GG., Bright NA., Gray SR., Pryor PR., Evans PR., Luzio JP., Owen DJ. DIP original experiment: DIP-251394X Nature structural & molecular biology 2012 IMEx The binding of Varp to VAMP7 traps VAMP7 in a closed, fusogenically inactive conformation. The binding of Varp to VAMP7 traps VAMP7 in a closed, fusogenically inactive conformation. The binding of Varp to VAMP7 traps VAMP7 in a closed, fusogenically inactive conformation. Nature structural & molecular biology 2012 imex curation Schäfer IB., Hesketh GG., Bright NA., Gray SR., Pryor PR., Evans PR., Luzio JP., Owen DJ. Only protein-protein interactions in vitro In vitro pull down pull down weight by comassie molecular weight estimation by coomasie staining weight by comassie Schäfer IB., Hesketh GG., Bright NA., Gray SR., Pryor PR., Evans PR., Luzio JP., Owen DJ. DIP original experiment: DIP-251400X Nature structural & molecular biology 2012 IMEx The binding of Varp to VAMP7 traps VAMP7 in a closed, fusogenically inactive conformation. The binding of Varp to VAMP7 traps VAMP7 in a closed, fusogenically inactive conformation. The binding of Varp to VAMP7 traps VAMP7 in a closed, fusogenically inactive conformation. Nature structural & molecular biology 2012 imex curation Schäfer IB., Hesketh GG., Bright NA., Gray SR., Pryor PR., Evans PR., Luzio JP., Owen DJ. Only protein-protein interactions in vitro In vitro pull down pull down weight by comassie molecular weight estimation by coomasie staining weight by comassie Schäfer IB., Hesketh GG., Bright NA., Gray SR., Pryor PR., Evans PR., Luzio JP., Owen DJ. DIP original experiment: DIP-251396X Nature structural & molecular biology 2012 IMEx The binding of Varp to VAMP7 traps VAMP7 in a closed, fusogenically inactive conformation. The binding of Varp to VAMP7 traps VAMP7 in a closed, fusogenically inactive conformation. The binding of Varp to VAMP7 traps VAMP7 in a closed, fusogenically inactive conformation. Nature structural & molecular biology 2012 imex curation Schäfer IB., Hesketh GG., Bright NA., Gray SR., Pryor PR., Evans PR., Luzio JP., Owen DJ. Only protein-protein interactions yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence Schäfer IB., Hesketh GG., Bright NA., Gray SR., Pryor PR., Evans PR., Luzio JP., Owen DJ. DIP original experiment: DIP-251385X Nature structural & molecular biology 2012 IMEx The binding of Varp to VAMP7 traps VAMP7 in a closed, fusogenically inactive conformation. The binding of Varp to VAMP7 traps VAMP7 in a closed, fusogenically inactive conformation. The binding of Varp to VAMP7 traps VAMP7 in a closed, fusogenically inactive conformation. Nature structural & molecular biology 2012 imex curation Schäfer IB., Hesketh GG., Bright NA., Gray SR., Pryor PR., Evans PR., Luzio JP., Owen DJ. Only protein-protein interactions yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid predetermined predetermined participant predetermined Schäfer IB., Hesketh GG., Bright NA., Gray SR., Pryor PR., Evans PR., Luzio JP., Owen DJ. DIP original experiment: DIP-251388X Nature structural & molecular biology 2012 IMEx The binding of Varp to VAMP7 traps VAMP7 in a closed, fusogenically inactive conformation. The binding of Varp to VAMP7 traps VAMP7 in a closed, fusogenically inactive conformation. The binding of Varp to VAMP7 traps VAMP7 in a closed, fusogenically inactive conformation. Nature structural & molecular biology 2012 imex curation Schäfer IB., Hesketh GG., Bright NA., Gray SR., Pryor PR., Evans PR., Luzio JP., Owen DJ. Only protein-protein interactions in vitro In vitro pull down pull down western blot western blot Immuno blot Immuno blot Schäfer IB., Hesketh GG., Bright NA., Gray SR., Pryor PR., Evans PR., Luzio JP., Owen DJ. DIP original experiment: DIP-251390X Nature structural & molecular biology 2012 IMEx The binding of Varp to VAMP7 traps VAMP7 in a closed, fusogenically inactive conformation. The binding of Varp to VAMP7 traps VAMP7 in a closed, fusogenically inactive conformation. The binding of Varp to VAMP7 traps VAMP7 in a closed, fusogenically inactive conformation. Nature structural & molecular biology 2012 imex curation Schäfer IB., Hesketh GG., Bright NA., Gray SR., Pryor PR., Evans PR., Luzio JP., Owen DJ. Only protein-protein interactions in vitro In vitro pull down pull down weight by comassie molecular weight estimation by coomasie staining weight by comassie Schäfer IB., Hesketh GG., Bright NA., Gray SR., Pryor PR., Evans PR., Luzio JP., Owen DJ. DIP original experiment: DIP-251402X Nature structural & molecular biology 2012 IMEx The binding of Varp to VAMP7 traps VAMP7 in a closed, fusogenically inactive conformation. The binding of Varp to VAMP7 traps VAMP7 in a closed, fusogenically inactive conformation. The binding of Varp to VAMP7 traps VAMP7 in a closed, fusogenically inactive conformation. Nature structural & molecular biology 2012 imex curation Schäfer IB., Hesketh GG., Bright NA., Gray SR., Pryor PR., Evans PR., Luzio JP., Owen DJ. Only protein-protein interactions yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence Schäfer IB., Hesketh GG., Bright NA., Gray SR., Pryor PR., Evans PR., Luzio JP., Owen DJ. DIP original experiment: DIP-251387X Nature structural & molecular biology 2012 IMEx The binding of Varp to VAMP7 traps VAMP7 in a closed, fusogenically inactive conformation. The binding of Varp to VAMP7 traps VAMP7 in a closed, fusogenically inactive conformation. The binding of Varp to VAMP7 traps VAMP7 in a closed, fusogenically inactive conformation. Nature structural & molecular biology 2012 imex curation Schäfer IB., Hesketh GG., Bright NA., Gray SR., Pryor PR., Evans PR., Luzio JP., Owen DJ. Only protein-protein interactions in vitro In vitro pull down pull down weight by comassie molecular weight estimation by coomasie staining weight by comassie Schäfer IB., Hesketh GG., Bright NA., Gray SR., Pryor PR., Evans PR., Luzio JP., Owen DJ. DIP original experiment: DIP-251403X Nature structural & molecular biology 2012 IMEx The binding of Varp to VAMP7 traps VAMP7 in a closed, fusogenically inactive conformation. The binding of Varp to VAMP7 traps VAMP7 in a closed, fusogenically inactive conformation. The binding of Varp to VAMP7 traps VAMP7 in a closed, fusogenically inactive conformation. Nature structural & molecular biology 2012 imex curation Schäfer IB., Hesketh GG., Bright NA., Gray SR., Pryor PR., Evans PR., Luzio JP., Owen DJ. Only protein-protein interactions in vitro In vitro pull down pull down weight by comassie molecular weight estimation by coomasie staining weight by comassie Schäfer IB., Hesketh GG., Bright NA., Gray SR., Pryor PR., Evans PR., Luzio JP., Owen DJ. DIP original experiment: DIP-251398X Nature structural & molecular biology 2012 IMEx The binding of Varp to VAMP7 traps VAMP7 in a closed, fusogenically inactive conformation. The binding of Varp to VAMP7 traps VAMP7 in a closed, fusogenically inactive conformation. The binding of Varp to VAMP7 traps VAMP7 in a closed, fusogenically inactive conformation. Nature structural & molecular biology 2012 imex curation Schäfer IB., Hesketh GG., Bright NA., Gray SR., Pryor PR., Evans PR., Luzio JP., Owen DJ. Only protein-protein interactions in vitro In vitro pull down pull down weight by comassie molecular weight estimation by coomasie staining weight by comassie Schäfer IB., Hesketh GG., Bright NA., Gray SR., Pryor PR., Evans PR., Luzio JP., Owen DJ. DIP original experiment: DIP-251404X Nature structural & molecular biology 2012 IMEx The binding of Varp to VAMP7 traps VAMP7 in a closed, fusogenically inactive conformation. The binding of Varp to VAMP7 traps VAMP7 in a closed, fusogenically inactive conformation. The binding of Varp to VAMP7 traps VAMP7 in a closed, fusogenically inactive conformation. Nature structural & molecular biology 2012 imex curation Schäfer IB., Hesketh GG., Bright NA., Gray SR., Pryor PR., Evans PR., Luzio JP., Owen DJ. Only protein-protein interactions in vitro In vitro pull down pull down weight by comassie molecular weight estimation by coomasie staining weight by comassie Schäfer IB., Hesketh GG., Bright NA., Gray SR., Pryor PR., Evans PR., Luzio JP., Owen DJ. DIP original experiment: DIP-251397X Nature structural & molecular biology 2012 IMEx The binding of Varp to VAMP7 traps VAMP7 in a closed, fusogenically inactive conformation. The binding of Varp to VAMP7 traps VAMP7 in a closed, fusogenically inactive conformation. The binding of Varp to VAMP7 traps VAMP7 in a closed, fusogenically inactive conformation. Nature structural & molecular biology 2012 imex curation Schäfer IB., Hesketh GG., Bright NA., Gray SR., Pryor PR., Evans PR., Luzio JP., Owen DJ. Only protein-protein interactions in vitro In vitro x-ray diffraction x-ray crystallography X-ray X-ray x-ray diffraction predetermined predetermined participant predetermined Schäfer IB., Hesketh GG., Bright NA., Gray SR., Pryor PR., Evans PR., Luzio JP., Owen DJ. DIP original experiment: DIP-251382X Nature structural & molecular biology 2012 IMEx The binding of Varp to VAMP7 traps VAMP7 in a closed, fusogenically inactive conformation. The binding of Varp to VAMP7 traps VAMP7 in a closed, fusogenically inactive conformation. The binding of Varp to VAMP7 traps VAMP7 in a closed, fusogenically inactive conformation. Nature structural & molecular biology 2012 imex curation Schäfer IB., Hesketh GG., Bright NA., Gray SR., Pryor PR., Evans PR., Luzio JP., Owen DJ. Only protein-protein interactions in vitro In vitro pull down pull down anti tag western anti tag western blot anti tag western Schäfer IB., Hesketh GG., Bright NA., Gray SR., Pryor PR., Evans PR., Luzio JP., Owen DJ. DIP original experiment: DIP-251392X Nature structural & molecular biology 2012 IMEx The binding of Varp to VAMP7 traps VAMP7 in a closed, fusogenically inactive conformation. The binding of Varp to VAMP7 traps VAMP7 in a closed, fusogenically inactive conformation. The binding of Varp to VAMP7 traps VAMP7 in a closed, fusogenically inactive conformation. Nature structural & molecular biology 2012 imex curation Schäfer IB., Hesketh GG., Bright NA., Gray SR., Pryor PR., Evans PR., Luzio JP., Owen DJ. Only protein-protein interactions in vitro In vitro itc isothermal titration calorimetry ITC ITC itc predetermined predetermined participant predetermined Schäfer IB., Hesketh GG., Bright NA., Gray SR., Pryor PR., Evans PR., Luzio JP., Owen DJ. DIP original experiment: DIP-251391X Nature structural & molecular biology 2012 IMEx The binding of Varp to VAMP7 traps VAMP7 in a closed, fusogenically inactive conformation. The binding of Varp to VAMP7 traps VAMP7 in a closed, fusogenically inactive conformation. The binding of Varp to VAMP7 traps VAMP7 in a closed, fusogenically inactive conformation. Nature structural & molecular biology 2012 imex curation Schäfer IB., Hesketh GG., Bright NA., Gray SR., Pryor PR., Evans PR., Luzio JP., Owen DJ. Only protein-protein interactions in vitro In vitro pull down pull down weight by comassie molecular weight estimation by coomasie staining weight by comassie Schäfer IB., Hesketh GG., Bright NA., Gray SR., Pryor PR., Evans PR., Luzio JP., Owen DJ. DIP original experiment: DIP-251405X Nature structural & molecular biology 2012 IMEx The binding of Varp to VAMP7 traps VAMP7 in a closed, fusogenically inactive conformation. The binding of Varp to VAMP7 traps VAMP7 in a closed, fusogenically inactive conformation. The binding of Varp to VAMP7 traps VAMP7 in a closed, fusogenically inactive conformation. Nature structural & molecular biology 2012 imex curation Schäfer IB., Hesketh GG., Bright NA., Gray SR., Pryor PR., Evans PR., Luzio JP., Owen DJ. Only protein-protein interactions in vitro In vitro pull down pull down weight by comassie molecular weight estimation by coomasie staining weight by comassie Schäfer IB., Hesketh GG., Bright NA., Gray SR., Pryor PR., Evans PR., Luzio JP., Owen DJ. DIP original experiment: DIP-251399X Nature structural & molecular biology 2012 IMEx The binding of Varp to VAMP7 traps VAMP7 in a closed, fusogenically inactive conformation. agfg1_human Arf-GAP domain and FG repeat-containing protein 1 HIV-1 Rev-binding protein Rev-interacting protein Rev/Rex activation domain-binding protein AGFG1 RAB RIP HRB Nucleoporin-like protein RIP protein protein human Homo sapiens Human MAASAKRKQEEKHLKMLRDMTGLPHNRKCFDCDQRGPTYVNMTVGSFVCTSCSGSLRGLNPPHRVKSISMTTFTQQEIEFLQKHGNEVCKQIWLGLFDDRSSAIPDFRDPQKVKEFLQEKYEKKRWYVPPEQAKVVASVHASISGSSASSTSSTPEVKPLKSLLGDSAPTLHLNKGTPSQSPVVGRSQGQQQEKKQFDLLSDLGSDIFAAPAPQSTATANFANFAHFNSHAAQNSANADFANFDAFGQSSGSSNFGGFPTASHSPFQPQTTGGSAASVNANFAHFDNFPKSSSADFGTFNTSQSHQTASAVSKVSTNKAGLQTADKYAALANLDNIFSAGQGGDQGSGFGTTGKAPVGSVVSVPSQSSASSDKYAALAELDSVFSSAATSSNAYTSTSNASSNVFGTVPVVASAQTQPASSSVPAPFGATPSTNPFVAAAGPSVASSTNPFQTNARGATAATFGTASMSMPTGFGTPAPYSLPTSFSGSFQQPAFPAQAAFPQQTAFSQQPNGAGFAAFGQTKPVVTPFGQVAAAGVSSNPFMTGAPTGQFPTGSSSTNPFL DIP protein P52594 original sequence version: 121 9A2242217F53B4D9 stx7_human Syntaxin-7 STX7 protein protein human Homo sapiens Human MSYTPGVGGDPAQLAQRISSNIQKITQCSVEIQRTLNQLGTPQDSPELRQQLQQKQQYTNQLAKETDKYIKEFGSLPTTPSEQRQRKIQKDRLVAEFTTSLTNFQKVQRQAAEREKEFVARVRASSRVSGSFPEDSSKERNLVSWESQTQPQVQVQDEEITEDDLRLIHERESSIRQLEADIMDINEIFKDLGMMIHEQGDVIDSIEANVENAEVHVQQANQQLSRAADYQRKSRKTLCIIILILVIGVAIISLIIWGLNH DIP protein O15400 original sequence version: 123 DIP protein O15400 original sequence version: 116 42AC173F0233ACDA ap3d1_human AP-3 complex subunit delta-1 AP-3 complex subunit delta Delta-adaptin AP3D1 PRO0039 Adaptor-related protein complex 3 subunit delta-1 protein protein human Homo sapiens Human MALKMVKGSIDRMFDKNLQDLVRGIRNHKEDEAKYISQCIDEIKQELKQDNIAVKANAVCKLTYLQMLGYDISWAAFNIIEVMSASKFTFKRIGYLAASQSFHEGTDVIMLTTNQIRKDLSSPSQYDTGVALTGLSCFVTPDLARDLANDIMTLMSHTKPYIRKKAVLIMYKVFLKYPESLRPAFPRLKEKLEDPDPGVQSAAVNVICELARRNPKNYLSLAPLFFKLMTSSTNNWVLIKIIKLFGALTPLEPRLGKKLIEPLTNLIHSTSAMSLLYECVNTVIAVLISLSSGMPNHSASIQLCVQKLRILIEDSDQNLKYLGLLAMSKILKTHPKSVQSHKDLILQCLDDKDESIRLRALDLLYGMVSKKNLMEIVKKLMTHVDKAEGTTYRDELLTKIIDICSQSNYQYITNFEWYISILVELTRLEGTRHGHLIAAQMLDVAIRVKAIRKFAVSQMSALLDSAHLLASSTQRNGICEVLYAAAWICGEFSEHLQEPHHTLEAMLRPRVTTLPGHIQAVYVQNVVKLYASILQQKEQAGEAEGAQAVTQLMVDRLPQFVQSADLEVQERASCILQLVKHIQKLQAKDVPVAEEVSALFAGELNPVAPKAQKKVPVPEGLDLDAWINEPLSDSESEDERPRAVFHEEEQRRPKHRPSEADEEELARRREARKQEQANNPFYIKSSPSPQKRYQDTPGVEHIPVVQIDLSVPLKVPGLPMSDQYVKLEEERRHRQKLEKDKRRKKRKEKEKKGKRRHSSLPTESDEDIAPAQQVDIVTEEMPENALPSDEDDKDPNDPYRALDIDLDKPLADSEKLPIQKHRNTETSKSPEKDVPMVEKKSKKPKKKEKKHKEKERDKEKKKEKEKKKSPKPKKKKHRKEKEERTKGKKKSKKQPPGSEEAAGEPVQNGAPEEEQLPPESSYSLLAENSYVKMTCDIRGSLQEDSQVTVAIVLENRSSSILKGMELSVLDSLNARMARPQGSSVHDGVPVPFQLPPGVSNEAQYVFTIQSIVMAQKLKGTLSFIAKNDEGATHEKLDFRLHFSCSSYLITTPCYSDAFAKLLESGDLSMSSIKVDGIRMSFQNLLAKICFHHHFSVVERVDSCASMYSRSIQGHHVCLLVKKGENSVSVDGKCSDSTLLSNLLEEMKATLAKC DIP protein O14617 original sequence version: 119 1B491DD64EAD5096 anr27_human Ankyrin repeat domain-containing protein 27 ANKRD27 VPS9 domain-containing protein PP12899 protein protein human Homo sapiens Human MALYDEDLLKNPFYLALQKCRPDLCSKVAQIHGIVLVPCKGSLSSSIQSTCQFESYILIPVEEHFQTLNGKDVFIQGNRIKLGAGFACLLSVPILFEETFYNEKEESFSILCIAHPLEKRESSEEPLAPSDPFSLKTIEDVREFLGRHSERFDRNIASFHRTFRECERKSLRHHIDSANALYTKCLQQLLRDSHLKMLAKQEAQMNLMKQAVEIYVHHEIYNLIFKYVGTMEASEDAAFNKITRSLQDLQQKDIGVKPEFSFNIPRAKRELAQLNKCTSPQQKLVCLRKVVQLITQSPSQRVNLETMCADDLLSVLLYLLVKTEIPNWMANLSYIKNFRFSSLAKDELGYCLTSFEAAIEYIRQGSLSAKPPESEGFGDRLFLKQRMSLLSQMTSSPTDCLFKHIASGNQKEVERLLSQEDHDKDTVQKMCHPLCFCDDCEKLVSGRLNDPSVVTPFSRDDRGHTPLHVAAVCGQASLIDLLVSKGAMVNATDYHGATPLHLACQKGYQSVTLLLLHYKASAEVQDNNGNTPLHLACTYGHEDCVKALVYYDVESCRLDIGNEKGDTPLHIAARWGYQGVIETLLQNGASTEIQNRLKETPLKCALNSKILSVMEAYHLSFERRQKSSEAPVQSPQRSVDSISQESSTSSFSSMSASSRQEETKKDYREVEKLLRAVADGDLEMVRYLLEWTEEDLEDAEDTVSAADPEFCHPLCQCPKCAPAQKRLAKVPASGLGVNVTSQDGSSPLHVAALHGRADLIPLLLKHGANAGARNADQAVPLHLACQQGHFQVVKCLLDSNAKPNKKDLSGNTPLIYACSGGHHELVALLLQHGASINASNNKGNTALHEAVIEKHVFVVELLLLHGASVQVLNKRQRTAVDCAEQNSKIMELLQVVPSCVASLDDVAETDRKEYVTVKIRKKWNSKLYDLPDEPFTRQFYFVHSAGQFKGKTSREIMARDRSVPNLTEGSLHEPGRQSVTLRQNNLPAQSGSHAAEKGNSDWPERPGLTQTGPGHRRMLRRHTVEDAVVSQGPEAAGPLSTPQEVSASRS DIP protein Q96NW4 original sequence version: 80 C47A96AA15E420F9 vamp7_mouse Vesicle-associated membrane protein 7 Vamp7 Sybl1 Synaptobrevin-like protein 1 protein protein mouse Mus musculus Mouse MAILFAVVARGTTILAKHAWCGGNFLEVTEQILAKIPSENNKLTYSHGNYLFHYICQDRIVYLCITDDDFERSRAFSFLNEVKKRFQTTYGSRAQTALPYAMNSEFSSVLAAQLKHHSENKSLDKVMETQAQVDELKGIMVRNIDLVAQRGERLELLIDKTENLVDSSVTFKTTSRNLARAMCMKNIKLTIIIIIVSIVFIYIIVSLLCGGFTWPNCVKK DIP protein P70280 original sequence version: 98 109DBA4BE5772B0C vamp8_human Vesicle-associated membrane protein 8 Endobrevin VAMP8 protein protein human Homo sapiens Human MEEASEGGGNDRVRNLQSEVEGVKNIMTQNVERILARGENLEHLRNKTEDLEATSEHFKTTSQKVARKFWWKNVKMIVLICVIVFIIILFIVLFATGAFS DIP protein Q9BV40 original sequence version: 108 DIP protein Q9BV40 original sequence version: 118 DIP protein Q9BV40 original sequence version: 100 018B986442BBD9B6 stx8_human Syntaxin-8 STX8 protein protein human Homo sapiens Human MAPDPWFSTYDSTCQIAQEIAEKIQQRNQYERKGEKAPKLTVTIRALLQNLKEKIALLKDLLLRAVSTHQITQLEGDRRQNLLDDLVTRERLLLASFKNEGAEPDLIRSSLMSEEAKRGAPNPWLFEEPEETRGLGFDEIRQQQQKIIQEQDAGLDALSSIISRQKQMGQEIGNELDEQNEIIDDLANLVENTDEKLRNETRRVNMVDRKSASCGMIMVILLLLVAIVVVAVWPTN DIP protein Q9UNK0 original sequence version: 153 DIP protein Q9UNK0 original sequence version: 119 DIP protein Q9UNK0 original sequence version: 100 DIP protein Q9UNK0 original sequence version: 114 1E64A0DA77584CC4 rab38_mouse Ras-related protein Rab-38 Rab38 protein protein mouse Mus musculus Mouse MQTPHKEHLYKLLVIGDLGVGKTSIIKRYVHQNFSSHYRATIGVDFALKVLHWDPETVVRLQLWDIAGQERFGNMTRVYYREAMGAFIVFDVTRPATFEAVAKWKNDLDSKLTLPNGKPVSVVLLANKCDQGKDVLMNNGLKMDQFCKEHGFVGWFETSAKENINIDEASRCLVKHILANECDLLESIEPDIVKPHLTSPKVVSCSGCAKS DIP protein Q8QZZ8 original sequence version: 90 61F84A88CDACC486 vti1b_mouse Vesicle transport through interaction with t-SNAREs homolog 1B Vesicle transport v-SNARE protein Vti1-like 1 Vti1-rp1 Vti1b Vti1l1 protein protein mouse Mus musculus Mouse MAASAASSEHFEKLHEIFRGLLEDLQGVPERLLGTAGTEEKKKLVRDFDENQQEANETLAEMEEELRYAPLTFRNPMMSKLRNYRKDLAKLHREVRSTPLTAAPGGRGDLKYGTYTLENEHLNRLQSQRALLLQGTESLNRATQSIERSHRIATETDQIGTEIIEELGEQRDQLERTKSRLVNTNENLSKSRKILRSMSRKVITNKLLLSVIILLELAILVGLVYYKFFRHH DIP protein O88384 original sequence version: 97 DIP protein O88384 original sequence version: 87 DIP protein O88384 original sequence version: 92 6827DCAF9650DFC6 snp29_human Synaptosomal-associated protein 29 Vesicle-membrane fusion protein SNAP-29 Soluble 29 kDa NSF attachment protein SNAP29 protein protein human Homo sapiens Human MSAYPKSYNPFDDDGEDEGARPAPWRDARDLPDGPDAPADRQQYLRQEVLRRAEATAASTSRSLALMYESEKVGVASSEELARQRGVLERTEKMVDKMDQDLKISQKHINSIKSVFGGLVNYFKSKPVETPPEQNGTLTSQPNNRLKEAISTSKEQEAKYQASHPNLRKLDDTDPVPRGAGSAMSTDAYPKNPHLRAYHQKIDSNLDELSMGLGRLKDIALGMQTEIEEQDDILDRLTTKVDKLDVNIKSTERKVRQL DIP protein O95721 original sequence version: 135 DIP protein O95721 original sequence version: 139 DIP protein O95721 original sequence version: 118 7E1CDBA22D6F5A3C ankrd27-vamp7-1 22 28 unspecified role unspecified role unspecified role unspecified role Region 658-921 Region 658-921 sufficient to bind sufficient binding region sufficient to bind deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain Q96NW4:p.[Asp679Ala;Asp681Ala] D679A/D681A mutation disrupting strength mutation disrupting interaction strength mutation disrupting strength alanine scanning alanine scanning certain certain sequence position certain certain certain sequence position certain D A certain certain sequence position certain certain certain sequence position certain D A This feature has been corrected as a result of our quality control procedures. The original label was 'D679A/D681A'. Wed May 02 14:47:43 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'asp679ala,asp681ala' Tue Jun 30 17:34:14 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.[Asp679Ala;Asp681Ala]' Q96NW4:p.[Met684Asp;Tyr687Ser] M684D/Y687S mutation disrupting strength mutation disrupting interaction strength mutation disrupting strength substitut analysis substitution analysis substitut analysis certain certain sequence position certain certain certain sequence position certain Y S certain certain sequence position certain certain certain sequence position certain M D This feature has been corrected as a result of our quality control procedures. The original label was 'M684D/Y687S'. Wed May 02 18:51:30 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'met684asp,tyr687ser' Tue Jun 30 17:08:38 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.[Met684Asp;Tyr687Ser]' ecolx Escherichia coli 29 unspecified role unspecified role unspecified role unspecified role Region 1-188 Region 1-188 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain ecolx Escherichia coli direct interaction direct interaction ankrd27-vamp7-2 20 28 unspecified role unspecified role unspecified role unspecified role Region 658-921 Region 658-921 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain ecolx Escherichia coli 29 unspecified role unspecified role unspecified role unspecified role Region 1-188 Region 1-188 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain ecolx Escherichia coli direct interaction direct interaction vamp7-ap3d1-2 5 27 unspecified role unspecified role prey prey yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 29 unspecified role unspecified role bait bait Region 1-120 Region 1-120 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast direct interaction direct interaction vti1b-vamp7-1 9 33 unspecified role unspecified role bait bait Region 117-206 Region 117-206 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain GST-tag GST-tag gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range ecolx Escherichia coli 29 unspecified role unspecified role prey prey Region 1-188 Region 1-188 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain ecolx Escherichia coli physical association physical association ankrd27-vamp7-3 8 28 unspecified role unspecified role unspecified role unspecified role Region 658-921 Region 658-921 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain ecolx Escherichia coli 29 unspecified role unspecified role unspecified role unspecified role Region 1-188 Region 1-188 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain P70280:p.[Asp69Ala;Glu71Phe;Ser73Asp] D69A/E71F/S73D mutation disrupting strength mutation disrupting interaction strength mutation disrupting strength substitut analysis substitution analysis substitut analysis certain certain sequence position certain certain certain sequence position certain S D certain certain sequence position certain certain certain sequence position certain E F certain certain sequence position certain certain certain sequence position certain D A This feature has been corrected as a result of our quality control procedures. The original label was 'D69A/E71F/S73D'. Wed May 02 19:54:18 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'asp69ala,glu71phe,ser73asp' Tue Jun 30 18:54:33 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.[Asp69Ala;Glu71Phe;Ser73Asp]' P70280:p.Arg72Ala R72A mutation disrupting strength mutation disrupting interaction strength mutation disrupting strength alanine scanning alanine scanning certain certain sequence position certain certain certain sequence position certain R A This feature has been corrected as a result of our quality control procedures. The original label was 'R72A'. Wed May 02 17:57:38 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'arg72ala' Tue Jun 30 17:00:02 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Arg72Ala' ecolx Escherichia coli direct interaction direct interaction vamp7-agfg1-1 15 25 unspecified role unspecified role prey prey yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 29 unspecified role unspecified role bait bait Region 1-120 Region 1-120 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast direct interaction direct interaction vamp7-stx7-1 24 26 unspecified role unspecified role prey prey Region 169-237 Region 169-237 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain ecolx Escherichia coli 33 unspecified role unspecified role prey prey Region 1-206 Region 1-206 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain ecolx Escherichia coli 29 unspecified role unspecified role bait bait GST-tag GST-tag gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range Region 1-188 Region 1-188 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain ecolx Escherichia coli association association vti1b-stx7-1 14 30 unspecified role unspecified role prey prey Region 1-76 Region 1-76 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain ecolx Escherichia coli 31 unspecified role unspecified role prey prey Region 149-213 Region 149-213 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain ecolx Escherichia coli 26 unspecified role unspecified role prey prey Region 169-237 Region 169-237 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain ecolx Escherichia coli 33 unspecified role unspecified role bait bait Region 117-206 Region 117-206 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain GST-tag GST-tag gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range ecolx Escherichia coli 29 unspecified role unspecified role prey prey Region 1-188 Region 1-188 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain ecolx Escherichia coli association association ankrd27-vamp7-4 1 28 unspecified role unspecified role unspecified role unspecified role Region 658-921 Region 658-921 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain ecolx Escherichia coli 29 unspecified role unspecified role unspecified role unspecified role Region 1-188 Region 1-188 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain ecolx Escherichia coli direct interaction direct interaction vti1b-stx7-2 18 31 unspecified role unspecified role prey prey Region 149-213 Region 149-213 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain ecolx Escherichia coli 26 unspecified role unspecified role prey prey Region 169-237 Region 169-237 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain ecolx Escherichia coli 33 unspecified role unspecified role bait bait Region 117-206 Region 117-206 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain GST-tag GST-tag gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range ecolx Escherichia coli 29 unspecified role unspecified role prey prey Region 1-188 Region 1-188 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain ecolx Escherichia coli association association vamp7-ankrd27-5 7 28 unspecified role unspecified role prey prey Region 658-921 Region 658-921 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain Q96NW4:p.[Met684Asp;Tyr687Ser] M684D/Y687S mutation disrupting strength mutation disrupting interaction strength mutation disrupting strength substitut analysis substitution analysis substitut analysis certain certain sequence position certain certain certain sequence position certain Y S certain certain sequence position certain certain certain sequence position certain M D This feature has been corrected as a result of our quality control procedures. The original label was 'M684D/Y687S'. Wed May 02 14:34:06 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'met684asp,tyr687ser' Tue Jun 30 16:23:08 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.[Met684Asp;Tyr687Ser]' ecolx Escherichia coli 29 unspecified role unspecified role bait bait GST-tag GST-tag gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range Region 1-188 Region 1-188 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain ecolx Escherichia coli direct interaction direct interaction vamp7-ankrd27-6 21 28 unspecified role unspecified role prey prey His-tag His-tag his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range Region 658-921 Region 658-921 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain ecolx Escherichia coli 29 unspecified role unspecified role bait bait Region 1-160 Region 1-160 sufficient to bind sufficient binding region sufficient to bind deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain GST-tag GST-tag gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range ecolx Escherichia coli direct interaction direct interaction vamp7-ankrd27-7 19 31 unspecified role unspecified role prey prey Region 149-213 Region 149-213 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain ecolx Escherichia coli 26 unspecified role unspecified role prey prey Region 169-237 Region 169-237 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain ecolx Escherichia coli 33 unspecified role unspecified role prey prey Region 1-206 Region 1-206 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain ecolx Escherichia coli 28 unspecified role unspecified role prey prey Region 658-921 Region 658-921 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain ecolx Escherichia coli 29 unspecified role unspecified role bait bait GST-tag GST-tag gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range Region 1-188 Region 1-188 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain ecolx Escherichia coli association association vamp7-ankrd27-8 12 28 unspecified role unspecified role prey prey yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 29 unspecified role unspecified role bait bait Region 1-188 Region 1-188 sufficient to bind sufficient binding region sufficient to bind deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast direct interaction direct interaction vamp7-ankrd27-9 2 28 unspecified role unspecified role prey prey Region 671-731 Region 671-731 sufficient to bind sufficient binding region sufficient to bind full dna sequence full identification by DNA sequencing full dna sequence certain certain sequence position certain certain certain sequence position certain yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 29 unspecified role unspecified role bait bait Region 1-188 Region 1-188 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast direct interaction direct interaction vamp7-ankrd27-10 10 33 unspecified role unspecified role prey prey Region 1-206 Region 1-206 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain ecolx Escherichia coli 28 unspecified role unspecified role prey prey Region 658-921 Region 658-921 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain ecolx Escherichia coli 29 unspecified role unspecified role bait bait GST-tag GST-tag gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range Region 1-188 Region 1-188 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain ecolx Escherichia coli association association vti1b-stx7-3 3 26 unspecified role unspecified role prey prey Region 169-237 Region 169-237 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain ecolx Escherichia coli 33 unspecified role unspecified role bait bait Region 117-206 Region 117-206 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain GST-tag GST-tag gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range ecolx Escherichia coli 29 unspecified role unspecified role prey prey Region 1-188 Region 1-188 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain ecolx Escherichia coli association association ankrd27-vamp7-5 6 28 unspecified role unspecified role bait bait yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 29 unspecified role unspecified role prey prey Region 1-188 Region 1-188 sufficient to bind sufficient binding region sufficient to bind deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast direct interaction direct interaction vamp7-snap29-1 11 34 unspecified role unspecified role prey prey yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 29 unspecified role unspecified role bait bait Region 1-188 Region 1-188 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast direct interaction direct interaction vti1b-stx7-4 16 30 unspecified role unspecified role prey prey Region 1-76 Region 1-76 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain ecolx Escherichia coli 31 unspecified role unspecified role prey prey Region 149-213 Region 149-213 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain ecolx Escherichia coli 26 unspecified role unspecified role prey prey Region 169-237 Region 169-237 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain ecolx Escherichia coli 33 unspecified role unspecified role bait bait Region 117-206 Region 117-206 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain GST-tag GST-tag gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range ecolx Escherichia coli association association rab38-ankrd27-3 23 32 unspecified role unspecified role bait bait Q8QZZ8:p.Thr23Asn T23N mutation disrupting strength mutation disrupting interaction strength mutation disrupting strength substitut analysis substitution analysis substitut analysis certain certain sequence position certain certain certain sequence position certain T N This feature has been corrected as a result of our quality control procedures. The original label was 'T23N'. Wed May 02 19:35:12 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'thr23asn' Tue Jun 30 17:40:37 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Thr23Asn' GST-tag GST-tag gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range ecolx Escherichia coli 28 unspecified role unspecified role prey prey His-tag His-tag his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range Region 451-921 Region 451-921 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain ecolx Escherichia coli 29 unspecified role unspecified role prey prey Region 1-188 Region 1-188 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain His-tag His-tag his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range ecolx Escherichia coli association association vamp7-stx7-2 17 31 unspecified role unspecified role prey prey Region 149-213 Region 149-213 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain ecolx Escherichia coli 26 unspecified role unspecified role prey prey Region 169-237 Region 169-237 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain ecolx Escherichia coli 33 unspecified role unspecified role prey prey Region 1-206 Region 1-206 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain ecolx Escherichia coli 29 unspecified role unspecified role bait bait GST-tag GST-tag gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range Region 1-188 Region 1-188 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain ecolx Escherichia coli association association vamp7-ankrd27-11 4 28 unspecified role unspecified role prey prey His-tag His-tag his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range Region 658-921 Region 658-921 sufficient to bind sufficient binding region sufficient to bind deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain ecolx Escherichia coli 29 unspecified role unspecified role bait bait GST-tag GST-tag gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range Region 1-188 Region 1-188 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain ecolx Escherichia coli direct interaction direct interaction vamp7-ankrd27-12 13 28 unspecified role unspecified role prey prey human Homo sapiens Human 29 unspecified role unspecified role bait bait Region 1-188 Region 1-188 sufficient to bind sufficient binding region sufficient to bind deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain GST-tag GST-tag gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range ecolx Escherichia coli physical association physical association