DIP Database of Interacting Proteins 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ dip@mbi.ucla.edu Crystal structure of the Leishmania major peroxidase-cytochrome c complex. Crystal structure of the Leishmania major peroxidase-cytochrome c complex. Proceedings of the National Academy of Sciences of the United States of America 2012 imex curation Jasion VS., Doukov T., Pineda SH., Li H., Poulos TL. Only protein-protein interactions in vitro In vitro x-ray diffraction x-ray crystallography X-ray X-ray x-ray diffraction predetermined predetermined participant predetermined Jasion VS., Doukov T., Pineda SH., Li H., Poulos TL. DIP original experiment: DIP-253620X Proceedings of the National Academy of Sciences of the United States of America 2012 IMEx Crystal structure of the Leishmania major peroxidase-cytochrome c complex. Crystal structure of the Leishmania major peroxidase-cytochrome c complex. Crystal structure of the Leishmania major peroxidase-cytochrome c complex. Proceedings of the National Academy of Sciences of the United States of America 2012 imex curation Jasion VS., Doukov T., Pineda SH., Li H., Poulos TL. Only protein-protein interactions in vitro In vitro oxidoreduct assay oxidoreductase assay oxidoreduct assay predetermined predetermined participant predetermined Jasion VS., Doukov T., Pineda SH., Li H., Poulos TL. DIP original experiment: DIP-253621X Proceedings of the National Academy of Sciences of the United States of America 2012 IMEx Crystal structure of the Leishmania major peroxidase-cytochrome c complex. q4q3k2_leima APX LMJF_34_0070 protein protein leima Leishmania major MSGTSRRAKGLFTGIAVGTFVSGAMFVSCASARVEEPPFDIRALRADIEDMISEKLELGPSLIRLAWHEAASYDCFKKDGSPNSASMRFKPECLYAGNKGLDIPRKALETLKKKYPQISYADLWVLAAYVAIEYMGGPTIPFCWGRVDAKDGSVCGPDGRLPDGSKTQSHVREVFRRLGFNDQETVALIGAHTCGECHIEFSGYHGPWTHDKNGFDNSFFTQLLDEDWVLNPKVEQMQLMDRATTKLMMLPSDVCLLLDPSYRKYVELYAKDNDRFNKDFANAFKKLTELGTRNLHKAPASES DIP protein Q4Q3K2 original sequence version: 50 q4qen5_leima LMJF_16_1310 LMJF_16_1320 protein protein leima Leishmania major MPPKARAPLPPGDVERGEKLFKGRAAQCHTATKGGSNGVGPNLFGIVNRPSGKVEGFTYSKANAESGVIWTPEVLDVYLENPKKFMPGTKMSFAGIKKPQERADVIAYLETLK DIP protein Q4QEN5 original sequence version: 62 apx-q4qen5_leima-1 1 4 unspecified role unspecified role unspecified role unspecified role Region 11-113 Region 11-113 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain ecolx Escherichia coli 3 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli direct interaction direct interaction apx-q4qen5_leima-2 2 4 electron donor electron donor unspecified role unspecified role Region 11-113 Region 11-113 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain Q4QEN5:p.Arg24Ala R24A mutation decreasing rate mutation decreasing interaction rate mutation decreasing rate alanine scanning alanine scanning certain certain sequence position certain certain certain sequence position certain R A This feature has been corrected as a result of our quality control procedures. The original label was 'R24A'. Wed May 02 19:01:15 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'arg24ala' Tue Jun 30 17:31:14 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Arg24Ala' Q4QEN5:p.[Arg24Ala;Lys98Ala] R24A/K98A mutation decreasing rate mutation decreasing interaction rate mutation decreasing rate alanine scanning alanine scanning certain certain sequence position certain certain certain sequence position certain K A certain certain sequence position certain certain certain sequence position certain R A This feature has been corrected as a result of our quality control procedures. The original label was 'R24A/K98A'. Wed May 02 16:13:06 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'arg24ala,lys98ala' Tue Jun 30 17:53:12 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.[Arg24Ala;Lys98Ala]' Q4QEN5:p.Lys98Ala K98A mutation decreasing rate mutation decreasing interaction rate mutation decreasing rate alanine scanning alanine scanning certain certain sequence position certain certain certain sequence position certain K A This feature has been corrected as a result of our quality control procedures. The original label was 'K98A'. Wed May 02 15:31:13 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'lys98ala' Tue Jun 30 17:25:26 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Lys98Ala' ecolx Escherichia coli 3 electron acceptor electron acceptor unspecified role unspecified role ecolx Escherichia coli redox reaction oxidoreductase activity electron transfer reaction redox reaction