DIP Database of Interacting Proteins 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ dip@mbi.ucla.edu Structural basis of the PNRC2-mediated link between mrna surveillance and decapping. Structural basis of the PNRC2-mediated link between mrna surveillance and decapping. Structure (London, England : 1993) 2012 imex curation Lai T., Cho H., Liu Z., Bowler MW., Piao S., Parker R., Kim YK., Song H. Only protein-protein interactions yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid predetermined predetermined participant predetermined Lai T., Cho H., Liu Z., Bowler MW., Piao S., Parker R., Kim YK., Song H. DIP original experiment: DIP-251339X Structure (London, England : 1993) 2012 IMEx Structural basis of the PNRC2-mediated link between mrna surveillance and decapping. Structural basis of the PNRC2-mediated link between mrna surveillance and decapping. Structural basis of the PNRC2-mediated link between mrna surveillance and decapping. Structure (London, England : 1993) 2012 imex curation Lai T., Cho H., Liu Z., Bowler MW., Piao S., Parker R., Kim YK., Song H. Only protein-protein interactions yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid predetermined predetermined participant predetermined Lai T., Cho H., Liu Z., Bowler MW., Piao S., Parker R., Kim YK., Song H. DIP original experiment: DIP-251338X Structure (London, England : 1993) 2012 IMEx Structural basis of the PNRC2-mediated link between mrna surveillance and decapping. Structural basis of the PNRC2-mediated link between mrna surveillance and decapping. Structural basis of the PNRC2-mediated link between mrna surveillance and decapping. Structure (London, England : 1993) 2012 imex curation Lai T., Cho H., Liu Z., Bowler MW., Piao S., Parker R., Kim YK., Song H. Only protein-protein interactions human Homo sapiens Human anti tag coip anti tag coimmunoprecipitation anti tag coip anti tag western anti tag western blot anti tag western Lai T., Cho H., Liu Z., Bowler MW., Piao S., Parker R., Kim YK., Song H. DIP original experiment: DIP-251342X Structure (London, England : 1993) 2012 IMEx Structural basis of the PNRC2-mediated link between mrna surveillance and decapping. Structural basis of the PNRC2-mediated link between mrna surveillance and decapping. Structural basis of the PNRC2-mediated link between mrna surveillance and decapping. Structure (London, England : 1993) 2012 imex curation Lai T., Cho H., Liu Z., Bowler MW., Piao S., Parker R., Kim YK., Song H. Only protein-protein interactions ecolx Escherichia coli ion exchange chrom ion exchange chromatography IEC IEC ion exchange chrom predetermined predetermined participant predetermined Lai T., Cho H., Liu Z., Bowler MW., Piao S., Parker R., Kim YK., Song H. DIP original experiment: DIP-251336X Structure (London, England : 1993) 2012 IMEx Structural basis of the PNRC2-mediated link between mrna surveillance and decapping. Structural basis of the PNRC2-mediated link between mrna surveillance and decapping. Structural basis of the PNRC2-mediated link between mrna surveillance and decapping. Structure (London, England : 1993) 2012 imex curation Lai T., Cho H., Liu Z., Bowler MW., Piao S., Parker R., Kim YK., Song H. Only protein-protein interactions ecolx Escherichia coli molecular sieving molecular sieving Gel Filtration Size Exclusion Chromatography Size Exclusion Chromatography Gel Filtration Sizing column predetermined predetermined participant predetermined Lai T., Cho H., Liu Z., Bowler MW., Piao S., Parker R., Kim YK., Song H. DIP original experiment: DIP-251335X Structure (London, England : 1993) 2012 IMEx Structural basis of the PNRC2-mediated link between mrna surveillance and decapping. Structural basis of the PNRC2-mediated link between mrna surveillance and decapping. Structural basis of the PNRC2-mediated link between mrna surveillance and decapping. Structure (London, England : 1993) 2012 imex curation Lai T., Cho H., Liu Z., Bowler MW., Piao S., Parker R., Kim YK., Song H. Only protein-protein interactions in vitro In vitro pull down pull down anti tag western anti tag western blot anti tag western Lai T., Cho H., Liu Z., Bowler MW., Piao S., Parker R., Kim YK., Song H. DIP original experiment: DIP-251341X Structure (London, England : 1993) 2012 IMEx Structural basis of the PNRC2-mediated link between mrna surveillance and decapping. Structural basis of the PNRC2-mediated link between mrna surveillance and decapping. Structural basis of the PNRC2-mediated link between mrna surveillance and decapping. Structure (London, England : 1993) 2012 imex curation Lai T., Cho H., Liu Z., Bowler MW., Piao S., Parker R., Kim YK., Song H. Only protein-protein interactions human Homo sapiens Human anti tag coip anti tag coimmunoprecipitation anti tag coip western blot western blot Immuno blot Immuno blot Lai T., Cho H., Liu Z., Bowler MW., Piao S., Parker R., Kim YK., Song H. DIP original experiment: DIP-251340X Structure (London, England : 1993) 2012 IMEx Structural basis of the PNRC2-mediated link between mrna surveillance and decapping. Structural basis of the PNRC2-mediated link between mrna surveillance and decapping. Structural basis of the PNRC2-mediated link between mrna surveillance and decapping. Structure (London, England : 1993) 2012 imex curation Lai T., Cho H., Liu Z., Bowler MW., Piao S., Parker R., Kim YK., Song H. Only protein-protein interactions ecolx Escherichia coli x-ray diffraction x-ray crystallography X-ray X-ray x-ray diffraction predetermined predetermined participant predetermined Lai T., Cho H., Liu Z., Bowler MW., Piao S., Parker R., Kim YK., Song H. DIP original experiment: DIP-251337X Structure (London, England : 1993) 2012 IMEx Structural basis of the PNRC2-mediated link between mrna surveillance and decapping. dcp2_human m7GpppN-mRNA hydrolase Nucleoside diphosphate-linked moiety X motif 20 DCP2 NUDT20 mRNA-decapping enzyme 2 protein protein human Homo sapiens Human METKRVEIPGSVLDDLCSRFILHIPSEERDNAIRVCFQIELAHWFYLDFYMQNTPGLPQCGIRDFAKAVFSHCPFLLPQGEDVEKVLDEWKEYKMGVPTYGAIILDETLENVLLVQGYLAKSGWGFPKGKVNKEEAPHDCAAREVFEETGFDIKDYICKDDYIELRINDQLARLYIIPGIPKDTKFNPKTRREIRNIEWFSIEKLPCHRNDMTPKSKLGLAPNKFFMAIPFIRPLRDWLSRRFGDSSDSDNGFSSTGSTPAKPTVEKLSRTKFRHSQQLFPDGSPGDQWVKHRQPLQQKPYNNHSEMSDLLKGKNQSMRGNGRKQYQDSPNQKKRTNGLQPAKQQNSLMKCEKKLHPRKLQDNFETDAVYDLPSSSEDQLLEHAEGQPVACNGHCKFPFSSRAFLSFKFDHNAIMKILDL DIP protein Q8IU60 original sequence version: 72 DIP protein Q8IU60 original sequence version: 94 DIP protein Q8IU60 original sequence version: 95 C0FA503A0C797967 q9npj4-1 Proline-rich nuclear receptor coactivator 2 PNRC2 HSPC208 protein protein human Homo sapiens Human MGGGERYNIPAPQSRNVSKNQQQLNRQKTKEQNSQMKIVHKKKERGHGYNSSAAAWQAMQNGGKNKNFPNNQSWNSSLSGPRLLFKSQANQNYAGAKFSEPPSPSVLPKPPSHWVPVSFNPSDKEIMTFQLKTLLKVQV DIP protein Q9NPJ4-1 original sequence version: 96 dcp1a_human mRNA-decapping enzyme 1A DCP1A Transcription factor SMIF Smad4-interacting transcriptional co-activator SMIF protein protein human Homo sapiens Human MEALSRAGQEMSLAALKQHDPYITSIADLTGQVALYTFCPKANQWEKTDIEGTLFVYRRSASPYHGFTIVNRLNMHNLVEPVNKDLEFQLHEPFLLYRNASLSIYSIWFYDKNDCHRIAKLMADVVEEETRRSQQAARDKQSPSQANGCSDHRPIDILEMLSRAKDEYERNQMGDSNISSPGLQPSTQLSNLGSTETLEEMPSGSQDKSAPSGHKHLTVEELFGTSLPKEQPAVVGLDSEEMERLPGDASQKEPNSFLPFPFEQLGGAPQSETLGVPSAAHHSVQPEITTPVLITPASITQSNEKHAPTYTIPLSPVLSPTLPAEAPTAQVPPSLPRNSTMMQAVKTTPRQRSPLLNQPVPELSHASLIANQSPFRAPLNVTNTAGTSLPSVDLLQKLRLTPQHDQIQTQPLGKGAMVASFSPAAGQLATPESFIEPPSKTAAARVAASASLSNMVLAPLQSMQQNQDPEVFVQPKVLSSAIPVAGAPLVTATTTAVSSVLLAPSVFQQTVTRSSDLERKASSPSPLTIGTPESQRKPSIILSKSQLQDTLIHLIKNDSSFLSTLHEVYLQVLTKNKDNHNL DIP protein Q9NPI6 original sequence version: 76 DIP protein Q9NPI6 original sequence version: 96 DIP protein Q9NPI6 original sequence version: 120 26480D0B10CE7C72 pnrc2-dcp1a-5 1 11 unspecified role unspecified role prey prey Q9NPI6:p.Leu96Ala L96A mutation disrupting strength mutation disrupting interaction strength mutation disrupting strength alanine scanning alanine scanning certain certain sequence position certain certain certain sequence position certain L A This feature has been corrected as a result of our quality control procedures. The original label was 'L96A'. Wed May 02 18:33:03 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'leu96ala' Tue Jun 30 15:38:54 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Leu96Ala' Q9NPI6:p.Tyr36Ala Y36A mutation decreasing strength mutation decreasing interaction strength mutation decreasing strength alanine scanning alanine scanning certain certain sequence position certain certain certain sequence position certain Y A This feature has been corrected as a result of our quality control procedures. The original label was 'Y36A'. Wed May 02 17:24:53 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'tyr36ala' Tue Jun 30 19:17:15 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Tyr36Ala' Q9NPI6:p.Trp45Ala W45A mutation decreasing strength mutation decreasing interaction strength mutation decreasing strength alanine scanning alanine scanning certain certain sequence position certain certain certain sequence position certain W A This feature has been corrected as a result of our quality control procedures. The original label was 'W45A'. Wed May 02 18:47:06 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'trp45ala' Tue Jun 30 16:22:23 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Trp45Ala' Q9NPI6:p.Phe94Ala F94A mutation decreasing strength mutation decreasing interaction strength mutation decreasing strength alanine scanning alanine scanning certain certain sequence position certain certain certain sequence position certain F A This feature has been corrected as a result of our quality control procedures. The original label was 'F94A'. Wed May 02 15:38:25 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'phe94ala' Tue Jun 30 18:46:26 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Phe94Ala' Q9NPI6:p.Arg98Ala R98A mutation decreasing strength mutation decreasing interaction strength mutation decreasing strength alanine scanning alanine scanning certain certain sequence position certain certain certain sequence position certain R A This feature has been corrected as a result of our quality control procedures. The original label was 'R98A'. Wed May 02 20:30:49 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'arg98ala' Tue Jun 30 16:23:18 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Arg98Ala' yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 10 unspecified role unspecified role bait bait yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast direct interaction direct interaction dcp1a-pnrc2-3 8 11 unspecified role unspecified role unspecified role unspecified role Region 1-130 Region 1-130 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain ecolx Escherichia coli 10 unspecified role unspecified role unspecified role unspecified role Region 1-121 Region 1-121 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain ecolx Escherichia coli direct interaction direct interaction dcp1a-pnrc2-4 5 11 unspecified role unspecified role unspecified role unspecified role Region 1-130 Region 1-130 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain ecolx Escherichia coli 10 unspecified role unspecified role unspecified role unspecified role Region 1-121 Region 1-121 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain ecolx Escherichia coli direct interaction direct interaction dcp2-dcp1a-4 3 9 unspecified role unspecified role bait bait Flag-tag Flag-tag flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged n-term range n-terminal range n-term range n-term range n-terminal range n-term range human Homo sapiens Human 11 unspecified role unspecified role prey prey human Homo sapiens Human physical association physical association pnrc2-dcp2-1 6 9 unspecified role unspecified role prey prey GST-tag GST-tag gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range Region 1-245 Region 1-245 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain [EBI-16018833]The shifted ranges (1-245) couldn't be applied as the new full feature sequence is different from the previous one. [EBI-16018833]1-245 [EBI-16018833]Q8IU60,2 ecolx Escherichia coli 10 unspecified role unspecified role bait bait Region 1-121 Region 1-121 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain His-tag His-tag his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined ecolx Escherichia coli physical association physical association pnrc2-dcp1a-6 2 11 unspecified role unspecified role prey prey yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 10 unspecified role unspecified role bait bait Q9NPJ4-1:p.Trp114Ala W114A mutation disrupting strength mutation disrupting interaction strength mutation disrupting strength alanine scanning alanine scanning certain certain sequence position certain certain certain sequence position certain W A This feature has been corrected as a result of our quality control procedures. The original label was 'W114A'. Wed May 02 16:49:46 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'trp114ala' Tue Jun 30 20:26:05 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Trp114Ala' Q9NPJ4-1:p.Lys109Ala K109A mutation disrupting strength mutation disrupting interaction strength mutation disrupting strength alanine scanning alanine scanning certain certain sequence position certain certain certain sequence position certain K A This feature has been corrected as a result of our quality control procedures. The original label was 'K109A'. Wed May 02 19:56:30 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'lys109ala' Tue Jun 30 20:00:18 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Lys109Ala' Q9NPJ4-1:p.Pro108Ala P108A mutation decreasing strength mutation decreasing interaction strength mutation decreasing strength alanine scanning alanine scanning certain certain sequence position certain certain certain sequence position certain P A This feature has been corrected as a result of our quality control procedures. The original label was 'P108A'. Wed May 02 18:48:48 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'pro108ala' Tue Jun 30 19:51:34 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Pro108Ala' yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast direct interaction direct interaction dcp1a-pnrc2-5 4 11 unspecified role unspecified role unspecified role unspecified role Region 1-130 Region 1-130 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain ecolx Escherichia coli 10 unspecified role unspecified role unspecified role unspecified role Region 1-121 Region 1-121 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain ecolx Escherichia coli direct interaction direct interaction pnrc2-dcp1a-7 7 11 unspecified role unspecified role prey prey human Homo sapiens Human 10 unspecified role unspecified role bait bait Q9NPJ4-1:p.Trp114Ala W114A mutation disrupting strength mutation disrupting interaction strength mutation disrupting strength alanine scanning alanine scanning certain certain sequence position certain certain certain sequence position certain W A This feature has been corrected as a result of our quality control procedures. The original label was 'W114A'. Wed May 02 16:04:39 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'trp114ala' Tue Jun 30 16:16:40 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Trp114Ala' Q9NPJ4-1:p.Pro108Ala P108A mutation decreasing strength mutation decreasing interaction strength mutation decreasing strength alanine scanning alanine scanning certain certain sequence position certain certain certain sequence position certain P A This feature has been corrected as a result of our quality control procedures. The original label was 'P108A'. Wed May 02 15:17:21 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'pro108ala' Tue Jun 30 19:16:34 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Pro108Ala' Myc-tag Myc-tag myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined human Homo sapiens Human physical association physical association