DIP Database of Interacting Proteins 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ dip@mbi.ucla.edu Structure and function of Zucchini endoribonuclease in piRNA biogenesis. Structure and function of Zucchini endoribonuclease in piRNA biogenesis. Nature 2012 imex curation Nishimasu H., Ishizu H., Saito K., Fukuhara S., Kamatani MK., Bonnefond L., Matsumoto N., Nishizawa T., Nakanaga K., Aoki J., Ishitani R., Siomi H., Siomi MC., Nureki O. Only protein-protein interactions ecolx Escherichia coli x-ray diffraction x-ray crystallography X-ray X-ray x-ray diffraction predetermined predetermined participant predetermined Nishimasu H., Ishizu H., Saito K., Fukuhara S., Kamatani MK., Bonnefond L., Matsumoto N., Nishizawa T., Nakanaga K., Aoki J., Ishitani R., Siomi H., Siomi MC., Nureki O. DIP original experiment: DIP-251207X Nature 2012 IMEx Structure and function of Zucchini endoribonuclease in piRNA biogenesis. Structure and function of Zucchini endoribonuclease in piRNA biogenesis. Structure and function of Zucchini endoribonuclease in piRNA biogenesis. Nature 2012 imex curation Nishimasu H., Ishizu H., Saito K., Fukuhara S., Kamatani MK., Bonnefond L., Matsumoto N., Nishizawa T., Nakanaga K., Aoki J., Ishitani R., Siomi H., Siomi MC., Nureki O. Only protein-protein interactions drome Drosophila melanogaster (Fruit fly) Fruit fly anti tag coip anti tag coimmunoprecipitation anti tag coip anti tag western anti tag western blot anti tag western Nishimasu H., Ishizu H., Saito K., Fukuhara S., Kamatani MK., Bonnefond L., Matsumoto N., Nishizawa T., Nakanaga K., Aoki J., Ishitani R., Siomi H., Siomi MC., Nureki O. DIP original experiment: DIP-251208X Nature 2012 IMEx Structure and function of Zucchini endoribonuclease in piRNA biogenesis. zuc_drome Mitochondrial cardiolipin hydrolase Protein zucchini CG12314 zuc Mitochondrial phospholipase protein protein drome Drosophila melanogaster (Fruit fly) Fruit fly MLITQIIMKQIRDYPIVSTISIAVSTVLASEVIWKLVQCSRSKREKASRVHEVIIFNELGEICAAVHMRNSSMGSQKPQVSPCCNTHCSLRNVAKIVEQIDRAVYSIDLAIYTFTSLFLADSIKRALQRGVIIRIISDGEMVYSKGSQISMLAQLGVPVRVPITTNLMHNKFCIIDGFERVEEIRLLRKLKFMRPCYSIVISGSVNWTALGLGGNWENCIITADDKLTATFQAEFQRMWRAFAKTEGSQIQLK DIP protein Q9VKD7 original sequence version: 69 4488BEA6DFF9E092 zuc-1 1 3 unspecified role unspecified role unspecified role unspecified role Region 41-253 Region 41-253 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain ecolx Escherichia coli direct interaction direct interaction zuc-zuc-1 2 3 unspecified role unspecified role prey prey Myc-tag Myc-tag myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range drome Drosophila melanogaster (Fruit fly) Fruit fly 3 unspecified role unspecified role bait bait Flag-tag Flag-tag flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged c-term range C-terminal range c-term range c-term range C-terminal range c-term range drome Drosophila melanogaster (Fruit fly) Fruit fly physical association physical association