DIP Database of Interacting Proteins 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ dip@mbi.ucla.edu MR1 presents microbial vitamin B metabolites to MAIT cells. MR1 presents microbial vitamin B metabolites to MAIT cells. Nature 2012 imex curation Kjer-Nielsen L., Patel O., Corbett AJ., Le Nours J., Meehan B., Liu L., Bhati M., Chen Z., Kostenko L., Reantragoon R., Williamson NA., Purcell AW., Dudek NL., McConville MJ., O'Hair RA., Khairallah GN., Godfrey DI., Fairlie DP., Rossjohn J., McCluskey J. Only protein-protein interactions in vitro In vitro ion exchange chrom ion exchange chromatography IEC IEC ion exchange chrom predetermined predetermined participant predetermined Kjer-Nielsen L., Patel O., Corbett AJ., Le Nours J., Meehan B., Liu L., Bhati M., Chen Z., Kostenko L., Reantragoon R., Williamson NA., Purcell AW., Dudek NL., McConville MJ., O'Hair RA., Khairallah GN., Godfrey DI., Fairlie DP., Rossjohn J., McCluskey J. DIP original experiment: DIP-251253X Nature 2012 IMEx MR1 presents microbial vitamin B metabolites to MAIT cells. MR1 presents microbial vitamin B metabolites to MAIT cells. MR1 presents microbial vitamin B metabolites to MAIT cells. Nature 2012 imex curation Kjer-Nielsen L., Patel O., Corbett AJ., Le Nours J., Meehan B., Liu L., Bhati M., Chen Z., Kostenko L., Reantragoon R., Williamson NA., Purcell AW., Dudek NL., McConville MJ., O'Hair RA., Khairallah GN., Godfrey DI., Fairlie DP., Rossjohn J., McCluskey J. Only protein-protein interactions in vitro In vitro molecular sieving molecular sieving Gel Filtration Size Exclusion Chromatography Size Exclusion Chromatography Gel Filtration Sizing column predetermined predetermined participant predetermined Kjer-Nielsen L., Patel O., Corbett AJ., Le Nours J., Meehan B., Liu L., Bhati M., Chen Z., Kostenko L., Reantragoon R., Williamson NA., Purcell AW., Dudek NL., McConville MJ., O'Hair RA., Khairallah GN., Godfrey DI., Fairlie DP., Rossjohn J., McCluskey J. DIP original experiment: DIP-251252X Nature 2012 IMEx MR1 presents microbial vitamin B metabolites to MAIT cells. MR1 presents microbial vitamin B metabolites to MAIT cells. MR1 presents microbial vitamin B metabolites to MAIT cells. Nature 2012 imex curation Kjer-Nielsen L., Patel O., Corbett AJ., Le Nours J., Meehan B., Liu L., Bhati M., Chen Z., Kostenko L., Reantragoon R., Williamson NA., Purcell AW., Dudek NL., McConville MJ., O'Hair RA., Khairallah GN., Godfrey DI., Fairlie DP., Rossjohn J., McCluskey J. Only protein-protein interactions in vitro In vitro x-ray diffraction x-ray crystallography X-ray X-ray x-ray diffraction predetermined predetermined participant predetermined Kjer-Nielsen L., Patel O., Corbett AJ., Le Nours J., Meehan B., Liu L., Bhati M., Chen Z., Kostenko L., Reantragoon R., Williamson NA., Purcell AW., Dudek NL., McConville MJ., O'Hair RA., Khairallah GN., Godfrey DI., Fairlie DP., Rossjohn J., McCluskey J. DIP original experiment: DIP-251254X Nature 2012 IMEx MR1 presents microbial vitamin B metabolites to MAIT cells. b2mg_human Beta-2-microglobulin B2M CDABP0092 HDCMA22P protein protein human Homo sapiens Human MSRSVALAVLALLSLSGLEAIQRTPKIQVYSRHPAENGKSNFLNCYVSGFHPSDIEVDLLKNGERIEKVEHSDLSFSKDWSFYLLYYTEFTPTEKDEYACRVNHVTLSQPKIVKWDRDM DIP protein P61769 original sequence version: null DIP protein P61769 original sequence version: 138 DIP protein P61769 original sequence version: 134 DIP protein P61769 original sequence version: 135 DIP protein P61769 original sequence version: 116 DIP protein P61769 original sequence version: 60 DIP protein P61769 original sequence version: 79 DIP protein P61769 original sequence version: 87 DIP protein P61769 original sequence version: 93 DIP protein P61769 original sequence version: 94 DIP protein P61769 original sequence version: 91 DIP protein P61769 original sequence version: 106 DIP protein P61769 original sequence version: 111 AFD2DBEF07DCEF27 q95460-1 Major histocompatibility complex class I-related gene protein MR1 Class I histocompatibility antigen-like protein MR1A protein protein human Homo sapiens Human MGELMAFLLPLIIVLMVKHSDSRTHSLRYFRLGVSDPIHGVPEFISVGYVDSHPITTYDSVTRQKEPRAPWMAENLAPDHWERYTQLLRGWQQMFKVELKRLQRHYNHSGSHTYQRMIGCELLEDGSTTGFLQYAYDGQDFLIFNKDTLSWLAVDNVAHTIKQAWEANQHELLYQKNWLEEECIAWLKRFLEYGKDTLQRTEPPLVRVNRKETFPGVTALFCKAHGFYPPEIYMTWMKNGEEIVQEIDYGDILPSGDGTYQAWASIELDPQSSNLYSCHVEHCGVHMVLQVPQESETIPLVMKAVSGSIVLVIVLAGVGVLVWRRRPREQNGAIYLPTPDR DIP protein Q95460-1 original sequence version: 109 b2m-mr1-1 3 4 unspecified role unspecified role unspecified role unspecified role Region 21-119 Region 21-119 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain ecolx Escherichia coli 5 unspecified role unspecified role unspecified role unspecified role Region 23-292 Region 23-292 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain ecolx Escherichia coli direct interaction direct interaction b2m-mr1-2 2 4 unspecified role unspecified role unspecified role unspecified role Region 21-119 Region 21-119 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain ecolx Escherichia coli 5 unspecified role unspecified role unspecified role unspecified role Region 23-292 Region 23-292 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain ecolx Escherichia coli direct interaction direct interaction b2m-mr1-3 1 4 unspecified role unspecified role unspecified role unspecified role Region 21-119 Region 21-119 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain ecolx Escherichia coli 5 unspecified role unspecified role unspecified role unspecified role Region 23-292 Region 23-292 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain ecolx Escherichia coli direct interaction direct interaction