DIP Database of Interacting Proteins 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ dip@mbi.ucla.edu Structure of the enzyme-acyl carrier protein (ACP) substrate gatekeeper complex required for biotin synthesis. Structure of the enzyme-acyl carrier protein (ACP) substrate gatekeeper complex required for biotin synthesis. Proceedings of the National Academy of Sciences of the United States of America 2012 imex curation Agarwal V., Lin S., Lukk T., Nair SK., Cronan JE. Only protein-protein interactions in vitro In vitro comig non denat gel comigration in non denaturing gel electrophoresis comig non denat gel predetermined predetermined participant predetermined Agarwal V., Lin S., Lukk T., Nair SK., Cronan JE. DIP original experiment: DIP-253618X Proceedings of the National Academy of Sciences of the United States of America 2012 IMEx Structure of the enzyme-acyl carrier protein (ACP) substrate gatekeeper complex required for biotin synthesis. Structure of the enzyme-acyl carrier protein (ACP) substrate gatekeeper complex required for biotin synthesis. Structure of the enzyme-acyl carrier protein (ACP) substrate gatekeeper complex required for biotin synthesis. Proceedings of the National Academy of Sciences of the United States of America 2012 imex curation Agarwal V., Lin S., Lukk T., Nair SK., Cronan JE. Only protein-protein interactions in vitro In vitro enzymatic study enzymatic study predetermined predetermined participant predetermined Agarwal V., Lin S., Lukk T., Nair SK., Cronan JE. DIP original experiment: DIP-253619X Proceedings of the National Academy of Sciences of the United States of America 2012 IMEx Structure of the enzyme-acyl carrier protein (ACP) substrate gatekeeper complex required for biotin synthesis. Structure of the enzyme-acyl carrier protein (ACP) substrate gatekeeper complex required for biotin synthesis. Structure of the enzyme-acyl carrier protein (ACP) substrate gatekeeper complex required for biotin synthesis. Proceedings of the National Academy of Sciences of the United States of America 2012 imex curation Agarwal V., Lin S., Lukk T., Nair SK., Cronan JE. Only protein-protein interactions in vitro In vitro x-ray diffraction x-ray crystallography X-ray X-ray x-ray diffraction predetermined predetermined participant predetermined Agarwal V., Lin S., Lukk T., Nair SK., Cronan JE. DIP original experiment: DIP-253617X Proceedings of the National Academy of Sciences of the United States of America 2012 IMEx Structure of the enzyme-acyl carrier protein (ACP) substrate gatekeeper complex required for biotin synthesis. acp_ecoli Acyl carrier protein acpP b1094 JW1080 Cytosolic-activating factor Fatty acid synthase acyl carrier protein protein protein ecoli Escherichia coli (strain K12) MSTIEERVKKIIGEQLGVKQEEVTNNASFVEDLGADSLDTVELVMALEEEFDTEIPDEEAEKITTVQAAIDYINGHQA DIP protein P0A6A8 original sequence version: 43 DIP protein P0A6A8 original sequence version: 56 DIP protein P0A6A8 original sequence version: 86 41FCFC39D45BFEA1 bioh_ecoli Pimeloyl-[acyl-carrier protein] methyl ester esterase Biotin synthesis protein BioH bioH bioB b3412 JW3375 Carboxylesterase BioH protein protein ecoli Escherichia coli (strain K12) MNNIWWQTKGQGNVHLVLLHGWGLNAEVWRCIDEELSSHFTLHLVDLPGFGRSRGFGALSLADMAEAVLQQAPDKAIWLGWSLGGLVASQIALTHPERVQALVTVASSPCFSARDEWPGIKPDVLAGFQQQLSDDFQRTVERFLALQTMGTETARQDARALKKTVLALPMPEVDVLNGGLEILKTVDLRQPLQNVSMPFLRLYGYLDGLVPRKVVPMLDKLWPHSESYIFAKAAHAPFISHPAEFCHLLVALKQRV DIP protein P13001 original sequence version: 119 931226F241BBCBF3 acpp-bioh-1 3 4 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli 5 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli direct interaction direct interaction acpp-bioh-2 1 4 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli 5 unspecified role unspecified role unspecified role unspecified role P13001:p.Ser82Ala S82A mutation mutation certain certain sequence position certain certain certain sequence position certain S A This feature has been corrected as a result of our quality control procedures. The original label was 'S82A'. Wed May 02 15:02:11 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'ser82ala' Tue Jun 30 19:44:56 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Ser82Ala' ecolx Escherichia coli direct interaction direct interaction acpp-bioh-3 2 4 enzyme target enzyme target substrate substrate unspecified role unspecified role ecolx Escherichia coli 5 enzyme enzyme unspecified role unspecified role P13001:p.Ser82Ala S82A mutation disrupting rate mutation disrupting interaction rate mutation disrupting rate alanine scanning alanine scanning certain certain sequence position certain certain certain sequence position certain S A This feature has been corrected as a result of our quality control procedures. The original label was 'S82A'. Wed May 02 20:09:56 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'ser82ala' Tue Jun 30 17:05:26 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Ser82Ala' P13001:p.[Arg138Ala;Arg142Ala;Arg155Ala] R138A/R142A/R155A mutation disrupting rate mutation disrupting interaction rate mutation disrupting rate alanine scanning alanine scanning certain certain sequence position certain certain certain sequence position certain R A certain certain sequence position certain certain certain sequence position certain R A certain certain sequence position certain certain certain sequence position certain R A This feature has been corrected as a result of our quality control procedures. The original label was 'R138A/R142A/R155A'. Wed May 02 19:45:47 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'arg138ala,arg142ala,arg155ala' Tue Jun 30 17:44:47 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.[Arg138Ala;Arg142Ala;Arg155Ala]' P13001:p.[Arg138Ala;Arg142Ala;Arg159Ala] R138A/R142A/R159A mutation disrupting rate mutation disrupting interaction rate mutation disrupting rate alanine scanning alanine scanning certain certain sequence position certain certain certain sequence position certain R A certain certain sequence position certain certain certain sequence position certain R A certain certain sequence position certain certain certain sequence position certain R A This feature has been corrected as a result of our quality control procedures. The original label was 'R138A/R142A/R159A'. Wed May 02 16:27:53 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'arg138ala,arg142ala,arg159ala' Tue Jun 30 18:26:02 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.[Arg138Ala;Arg142Ala;Arg159Ala]' P13001:p.[Arg138Ala;Arg142Ala;Arg155Ala;Arg159Ala] R138A/R142A/R155A/R159A mutation disrupting rate mutation disrupting interaction rate mutation disrupting rate alanine scanning alanine scanning certain certain sequence position certain certain certain sequence position certain R A certain certain sequence position certain certain certain sequence position certain R A certain certain sequence position certain certain certain sequence position certain R A certain certain sequence position certain certain certain sequence position certain R A This feature has been corrected as a result of our quality control procedures. The original label was 'R138A/R142A/R155A/R159A'. Wed May 02 14:53:53 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'arg138ala,arg142ala,arg155ala,arg159ala' Tue Jun 30 16:01:13 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.[Arg138Ala;Arg142Ala;Arg155Ala;Arg159Ala]' P13001:p.[Arg142Ala;Arg155Ala;Arg159Ala] R142A/R155A/R159A mutation disrupting rate mutation disrupting interaction rate mutation disrupting rate alanine scanning alanine scanning certain certain sequence position certain certain certain sequence position certain R A certain certain sequence position certain certain certain sequence position certain R A certain certain sequence position certain certain certain sequence position certain R A This feature has been corrected as a result of our quality control procedures. The original label was 'R142A/R155A/R159A'. Wed May 02 16:39:58 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'arg142ala,arg155ala,arg159ala' Tue Jun 30 18:36:19 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.[Arg142Ala;Arg155Ala;Arg159Ala]' P13001:p.[Arg138Ala;Arg155Ala;Arg159Ala] R138A/R155A/R159A mutation decreasing rate mutation decreasing interaction rate mutation decreasing rate alanine scanning alanine scanning certain certain sequence position certain certain certain sequence position certain R A certain certain sequence position certain certain certain sequence position certain R A certain certain sequence position certain certain certain sequence position certain R A This feature has been corrected as a result of our quality control procedures. The original label was 'R138A/R155A/R159A'. Wed May 02 19:48:19 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'arg138ala,arg155ala,arg159ala' Tue Jun 30 19:24:36 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.[Arg138Ala;Arg155Ala;Arg159Ala]' ecolx Escherichia coli enzymatic reaction enzymatic reaction Biochemical reaction Biochemical reaction