DIP Database of Interacting Proteins 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ dip@mbi.ucla.edu The survival motor neuron protein forms soluble glycine zipper oligomers. The survival motor neuron protein forms soluble glycine zipper oligomers. Structure (London, England : 1993) 2012 imex curation Martin R., Gupta K., Ninan NS., Perry K., Van Duyne GD. Only protein-protein interactions ecolx Escherichia coli solution sedimentati cosedimentation in solution solution sedimentati predetermined predetermined participant predetermined Martin R., Gupta K., Ninan NS., Perry K., Van Duyne GD. DIP original experiment: DIP-252371X Structure (London, England : 1993) 2012 IMEx The survival motor neuron protein forms soluble glycine zipper oligomers. The survival motor neuron protein forms soluble glycine zipper oligomers. The survival motor neuron protein forms soluble glycine zipper oligomers. Structure (London, England : 1993) 2012 imex curation Martin R., Gupta K., Ninan NS., Perry K., Van Duyne GD. Only protein-protein interactions ecolx Escherichia coli dls dynamic light scattering dls predetermined predetermined participant predetermined Martin R., Gupta K., Ninan NS., Perry K., Van Duyne GD. DIP original experiment: DIP-252373X Structure (London, England : 1993) 2012 IMEx The survival motor neuron protein forms soluble glycine zipper oligomers. The survival motor neuron protein forms soluble glycine zipper oligomers. The survival motor neuron protein forms soluble glycine zipper oligomers. Structure (London, England : 1993) 2012 imex curation Martin R., Gupta K., Ninan NS., Perry K., Van Duyne GD. Only protein-protein interactions ecolx Escherichia coli saxs x ray scattering saxs predetermined predetermined participant predetermined Martin R., Gupta K., Ninan NS., Perry K., Van Duyne GD. DIP original experiment: DIP-252375X Structure (London, England : 1993) 2012 IMEx The survival motor neuron protein forms soluble glycine zipper oligomers. The survival motor neuron protein forms soluble glycine zipper oligomers. The survival motor neuron protein forms soluble glycine zipper oligomers. Structure (London, England : 1993) 2012 imex curation Martin R., Gupta K., Ninan NS., Perry K., Van Duyne GD. Only protein-protein interactions ecolx Escherichia coli light scattering light scattering predetermined predetermined participant predetermined Martin R., Gupta K., Ninan NS., Perry K., Van Duyne GD. DIP original experiment: DIP-252377X Structure (London, England : 1993) 2012 IMEx The survival motor neuron protein forms soluble glycine zipper oligomers. The survival motor neuron protein forms soluble glycine zipper oligomers. The survival motor neuron protein forms soluble glycine zipper oligomers. Structure (London, England : 1993) 2012 imex curation Martin R., Gupta K., Ninan NS., Perry K., Van Duyne GD. Only protein-protein interactions ecolx Escherichia coli molecular sieving molecular sieving Gel Filtration Size Exclusion Chromatography Size Exclusion Chromatography Gel Filtration Sizing column predetermined predetermined participant predetermined Martin R., Gupta K., Ninan NS., Perry K., Van Duyne GD. DIP original experiment: DIP-252369X Structure (London, England : 1993) 2012 IMEx The survival motor neuron protein forms soluble glycine zipper oligomers. The survival motor neuron protein forms soluble glycine zipper oligomers. The survival motor neuron protein forms soluble glycine zipper oligomers. Structure (London, England : 1993) 2012 imex curation Martin R., Gupta K., Ninan NS., Perry K., Van Duyne GD. Only protein-protein interactions ecolx Escherichia coli solution sedimentati cosedimentation in solution solution sedimentati predetermined predetermined participant predetermined Martin R., Gupta K., Ninan NS., Perry K., Van Duyne GD. DIP original experiment: DIP-252374X Structure (London, England : 1993) 2012 IMEx The survival motor neuron protein forms soluble glycine zipper oligomers. The survival motor neuron protein forms soluble glycine zipper oligomers. The survival motor neuron protein forms soluble glycine zipper oligomers. Structure (London, England : 1993) 2012 imex curation Martin R., Gupta K., Ninan NS., Perry K., Van Duyne GD. Only protein-protein interactions ecolx Escherichia coli ion exchange chrom ion exchange chromatography IEC IEC ion exchange chrom predetermined predetermined participant predetermined Martin R., Gupta K., Ninan NS., Perry K., Van Duyne GD. DIP original experiment: DIP-252368X Structure (London, England : 1993) 2012 IMEx The survival motor neuron protein forms soluble glycine zipper oligomers. The survival motor neuron protein forms soluble glycine zipper oligomers. The survival motor neuron protein forms soluble glycine zipper oligomers. Structure (London, England : 1993) 2012 imex curation Martin R., Gupta K., Ninan NS., Perry K., Van Duyne GD. Only protein-protein interactions ecolx Escherichia coli x-ray diffraction x-ray crystallography X-ray X-ray x-ray diffraction predetermined predetermined participant predetermined Martin R., Gupta K., Ninan NS., Perry K., Van Duyne GD. DIP original experiment: DIP-252376X Structure (London, England : 1993) 2012 IMEx The survival motor neuron protein forms soluble glycine zipper oligomers. The survival motor neuron protein forms soluble glycine zipper oligomers. The survival motor neuron protein forms soluble glycine zipper oligomers. Structure (London, England : 1993) 2012 imex curation Martin R., Gupta K., Ninan NS., Perry K., Van Duyne GD. Only protein-protein interactions ecolx Escherichia coli light scattering light scattering predetermined predetermined participant predetermined Martin R., Gupta K., Ninan NS., Perry K., Van Duyne GD. DIP original experiment: DIP-252370X Structure (London, England : 1993) 2012 IMEx The survival motor neuron protein forms soluble glycine zipper oligomers. The survival motor neuron protein forms soluble glycine zipper oligomers. The survival motor neuron protein forms soluble glycine zipper oligomers. Structure (London, England : 1993) 2012 imex curation Martin R., Gupta K., Ninan NS., Perry K., Van Duyne GD. Only protein-protein interactions ecolx Escherichia coli molecular sieving molecular sieving Gel Filtration Size Exclusion Chromatography Size Exclusion Chromatography Gel Filtration Sizing column predetermined predetermined participant predetermined Martin R., Gupta K., Ninan NS., Perry K., Van Duyne GD. DIP original experiment: DIP-252372X Structure (London, England : 1993) 2012 IMEx The survival motor neuron protein forms soluble glycine zipper oligomers. smn_human Survival motor neuron protein SMN1 SMN SMNT SMN2 SMNC Component of gems 1 Gemin-1 protein protein human Homo sapiens Human MAMSSGGSGGGVPEQEDSVLFRRGTGQSDDSDIWDDTALIKAYDKAVASFKHALKNGDICETSGKPKTTPKRKPAKKNKSQKKNTAASLQQWKVGDKCSAIWSEDGCIYPATIASIDFKRETCVVVYTGYGNREEQNLSDLLSPICEVANNIEQNAQENENESQVSTDESENSRSPGNKSDNIKPKSAPWNSFLPPPPPMPGPRLGPGKPGLKFNGPPPPPPPPPPHLLSCWLPPFPSGPPIIPPPPPICPDSLDDADALGSMLISWYMSGYHTGYYMGFRQNQKEGRCSHSLN DIP protein Q16637 original sequence version: 129 DIP protein Q16637-1 original sequence version: 185 DIP protein Q16637 original sequence version: 182 DIP protein Q16637 original sequence version: 149 8A9A2A94192DCB9B q16637-2 Survival motor neuron protein SMN1 SMN SMNT SMN2 SMNC Iso5-SMN Component of gems 1 Gemin-1 protein protein human Homo sapiens Human MAMSSGGSGGGVPEQEDSVLFRRGTGQSDDSDIWDDTALIKAYDKAVASFKHALKNGDICETSGKPKTTPKRKPAKKNKSQKKNTAASLQQWKVGDKCSAIWSEDGCIYPATIASIDFKRETCVVVYTGYGNREEQNLSDLLSPICEVANNIEQNAQENENESQVSTDESENSRSPGNKSDNIKPKSAPWNSFLPPPPPMPGPRLGPGKIIPPPPPICPDSLDDADALGSMLISWYMSGYHTGYYMGFRQNQKEGRCSHSLN DIP protein Q16637-2 original sequence version: 149 gemi2_human Gem-associated protein 2 GEMIN2 SIP1 Component of gems 2 Survival of motor neuron protein-interacting protein 1 protein protein human Homo sapiens Human MRRAELAGLKTMAWVPAESAVEELMPRLLPVEPCDLTEGFDPSVPPRTPQEYLRRVQIEAAQCPDVVVAQIDPKKLKRKQSVNISLSGCQPAPEGYSPTLQWQQQQVAQFSTVRQNVNKHRSHWKSQQLDSNVTMPKSEDEEGWKKFCLGEKLCADGAVGPATNESPGIDYVQIGFPPLLSIVSRMNQATVTSVLEYLSNWFGERDFTPELGRWLYALLACLEKPLLPEAHSLIRQLARRCSEVRLLVDSKDDERVPALNLLICLVSRYFDQRDLADEPS DIP protein O14893 original sequence version: 146 DIP protein O14893 original sequence version: 114 3232F410EA98EB81 gemin2-smn1-5 7 13 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli 12 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli direct interaction direct interaction gemin2-smn1-6 1 13 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli 12 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli direct interaction direct interaction smn1-1 2 11 unspecified role unspecified role unspecified role unspecified role Region 263-294 Region 263-294 sufficient to bind sufficient binding region sufficient to bind deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain MBP-tag MBP-tag mbp tag maltose binding protein tag maltose binding protein tag maltose binding protein tag mbp tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range ecolx Escherichia coli direct interaction direct interaction smn1-3 6 11 unspecified role unspecified role unspecified role unspecified role Region 263-294 Region 263-294 sufficient to bind sufficient binding region sufficient to bind deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain MBP-tag MBP-tag mbp tag maltose binding protein tag maltose binding protein tag maltose binding protein tag mbp tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range ecolx Escherichia coli direct interaction direct interaction gemin2-smn1-7 5 13 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli 12 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli direct interaction direct interaction smn1-4 8 11 unspecified role unspecified role unspecified role unspecified role MBP-tag MBP-tag mbp tag maltose binding protein tag maltose binding protein tag maltose binding protein tag mbp tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range Region 263-294 Region 263-294 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain ecolx Escherichia coli direct interaction direct interaction smn1-5 10 11 unspecified role unspecified role unspecified role unspecified role Region 263-294 Region 263-294 sufficient to bind sufficient binding region sufficient to bind deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain MBP-tag MBP-tag mbp tag maltose binding protein tag maltose binding protein tag maltose binding protein tag mbp tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range Q16637:p.Gly279Val G279V mutation disrupting strength mutation disrupting interaction strength mutation disrupting strength substitut analysis substitution analysis substitut analysis certain certain sequence position certain certain certain sequence position certain G V This feature has been corrected as a result of our quality control procedures. The original label was 'G279V'. Wed May 02 18:19:41 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'gly279val' Tue Jun 30 18:49:26 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Gly279Val' Q16637:p.Gly275Ser G275S mutation disrupting strength mutation disrupting interaction strength mutation disrupting strength substitut analysis substitution analysis substitut analysis certain certain sequence position certain certain certain sequence position certain G S This feature has been corrected as a result of our quality control procedures. The original label was 'G275S'. Wed May 02 20:04:32 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'gly275ser' Tue Jun 30 16:32:45 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Gly275Ser' Q16637:p.Tyr272Cys Y272C mutation disrupting strength mutation disrupting interaction strength mutation disrupting strength substitut analysis substitution analysis substitut analysis certain certain sequence position certain certain certain sequence position certain Y C This feature has been corrected as a result of our quality control procedures. The original label was 'Y272C'. Wed May 02 15:58:51 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'tyr272cys' Tue Jun 30 16:34:36 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Tyr272Cys' Q16637:p.Ser266Pro S266P mutation disrupting strength mutation disrupting interaction strength mutation disrupting strength substitut analysis substitution analysis substitut analysis certain certain sequence position certain certain certain sequence position certain S P This feature has been corrected as a result of our quality control procedures. The original label was 'S266P'. Wed May 02 15:48:40 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'ser266pro' Tue Jun 30 20:06:00 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Ser266Pro' Q16637:p.Met263Arg M263R/T mutation disrupting strength mutation disrupting interaction strength mutation disrupting strength substitut analysis substitution analysis substitut analysis certain certain sequence position certain certain certain sequence position certain M R Wed May 02 16:05:58 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'met263arg' Tue Jun 30 17:36:54 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Met263Arg' Q16637:p.Leu260Ser L260S mutation disrupting strength mutation disrupting interaction strength mutation disrupting strength substitut analysis substitution analysis substitut analysis certain certain sequence position certain certain certain sequence position certain L S This feature has been corrected as a result of our quality control procedures. The original label was 'L260S'. Wed May 02 18:37:51 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'leu260ser' Tue Jun 30 17:43:26 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Leu260Ser' Q16637:p.Thr274Ala T274A mutation disrupting strength mutation disrupting interaction strength mutation disrupting strength alanine scanning alanine scanning certain certain sequence position certain certain certain sequence position certain T A This feature has been corrected as a result of our quality control procedures. The original label was 'T274A'. Wed May 02 18:15:53 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'thr274ala' Tue Jun 30 16:34:14 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Thr274Ala' Q16637:p.Gly271Ala G271A mutation disrupting strength mutation disrupting interaction strength mutation disrupting strength alanine scanning alanine scanning certain certain sequence position certain certain certain sequence position certain G A This feature has been corrected as a result of our quality control procedures. The original label was 'G271A'. Wed May 02 19:54:23 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'gly271ala' Tue Jun 30 16:13:08 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Gly271Ala' Q16637:p.Gly275Ala G275A mutation disrupting strength mutation disrupting interaction strength mutation disrupting strength alanine scanning alanine scanning certain certain sequence position certain certain certain sequence position certain G A This feature has been corrected as a result of our quality control procedures. The original label was 'G275A'. Wed May 02 19:21:34 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'gly275ala' Tue Jun 30 17:47:57 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Gly275Ala' Q16637:p.Tyr268Ala Y268A mutation disrupting strength mutation disrupting interaction strength mutation disrupting strength alanine scanning alanine scanning certain certain sequence position certain certain certain sequence position certain Y A This feature has been corrected as a result of our quality control procedures. The original label was 'Y268A'. Wed May 02 17:43:59 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'tyr268ala' Tue Jun 30 17:29:08 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Tyr268Ala' Q16637:p.Trp267Ala W267A mutation disrupting strength mutation disrupting interaction strength mutation disrupting strength alanine scanning alanine scanning certain certain sequence position certain certain certain sequence position certain W A This feature has been corrected as a result of our quality control procedures. The original label was 'W267A'. Wed May 02 20:30:05 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'trp267ala' Tue Jun 30 16:18:57 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Trp267Ala' Q16637:p.Met263Ala M263A mutation disrupting strength mutation disrupting interaction strength mutation disrupting strength alanine scanning alanine scanning certain certain sequence position certain certain certain sequence position certain M A This feature has been corrected as a result of our quality control procedures. The original label was 'M263A'. Wed May 02 19:39:08 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'met263ala' Tue Jun 30 16:33:27 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Met263Ala' Q16637:p.Leu264Ala L264A mutation disrupting strength mutation disrupting interaction strength mutation disrupting strength alanine scanning alanine scanning certain certain sequence position certain certain certain sequence position certain L A This feature has been corrected as a result of our quality control procedures. The original label was 'L264A'. Wed May 02 17:40:09 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'leu264ala' Tue Jun 30 16:19:25 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Leu264Ala' Q16637:p.Tyr272Ala Y272A mutation disrupting strength mutation disrupting interaction strength mutation disrupting strength alanine scanning alanine scanning certain certain sequence position certain certain certain sequence position certain Y A This feature has been corrected as a result of our quality control procedures. The original label was 'Y272A'. Wed May 02 19:13:40 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'tyr272ala' Tue Jun 30 17:34:05 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Tyr272Ala' Q16637:p.Thr274Ile T274I mutation decreasing strength mutation decreasing interaction strength mutation decreasing strength substitut analysis substitution analysis substitut analysis certain certain sequence position certain certain certain sequence position certain T I This feature has been corrected as a result of our quality control procedures. The original label was 'T274I'. Wed May 02 15:24:51 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'thr274ile' Tue Jun 30 17:45:50 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Thr274Ile' Q16637:p.Tyr276Ala Y276A mutation decreasing strength mutation decreasing interaction strength mutation decreasing strength alanine scanning alanine scanning certain certain sequence position certain certain certain sequence position certain Y A This feature has been corrected as a result of our quality control procedures. The original label was 'Y276A'. Wed May 02 16:51:51 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'tyr276ala' Tue Jun 30 15:58:56 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Tyr276Ala' Q16637:p.Tyr277Ala Y277A mutation decreasing strength mutation decreasing interaction strength mutation decreasing strength alanine scanning alanine scanning certain certain sequence position certain certain certain sequence position certain Y A This feature has been corrected as a result of our quality control procedures. The original label was 'Y277A'. Wed May 02 18:33:40 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'tyr277ala' Tue Jun 30 18:30:09 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Tyr277Ala' Q16637:p.Met269Ala M269A mutation decreasing strength mutation decreasing interaction strength mutation decreasing strength alanine scanning alanine scanning certain certain sequence position certain certain certain sequence position certain M A This feature has been corrected as a result of our quality control procedures. The original label was 'M269A'. Wed May 02 16:36:58 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'met269ala' Tue Jun 30 17:46:43 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Met269Ala' Q16637:p.Met263Thr mutation disrupting strength mutation disrupting interaction strength mutation disrupting strength certain certain sequence position certain certain certain sequence position certain M T Wed May 02 19:42:25 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'met263thr' Tue Jun 30 20:24:36 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Met263Thr' ecolx Escherichia coli direct interaction direct interaction gemin2-smn1-8 9 13 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli 12 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli direct interaction direct interaction smn1-6 4 11 unspecified role unspecified role unspecified role unspecified role Region 263-294 Region 263-294 sufficient to bind sufficient binding region sufficient to bind deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain MBP-tag MBP-tag mbp tag maltose binding protein tag maltose binding protein tag maltose binding protein tag mbp tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range Q16637:p.Gly279Val G279V mutation disrupting strength mutation disrupting interaction strength mutation disrupting strength substitut analysis substitution analysis substitut analysis certain certain sequence position certain certain certain sequence position certain G V This feature has been corrected as a result of our quality control procedures. The original label was 'G279V'. Wed May 02 15:42:09 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'gly279val' Tue Jun 30 20:00:38 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Gly279Val' Q16637:p.Gly275Ser G275S mutation disrupting strength mutation disrupting interaction strength mutation disrupting strength substitut analysis substitution analysis substitut analysis certain certain sequence position certain certain certain sequence position certain G S This feature has been corrected as a result of our quality control procedures. The original label was 'G275S'. Wed May 02 15:14:10 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'gly275ser' Tue Jun 30 18:25:09 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Gly275Ser' Q16637:p.Tyr272Cys Y272C mutation disrupting strength mutation disrupting interaction strength mutation disrupting strength substitut analysis substitution analysis substitut analysis certain certain sequence position certain certain certain sequence position certain Y C This feature has been corrected as a result of our quality control procedures. The original label was 'Y272C'. Wed May 02 14:59:08 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'tyr272cys' Tue Jun 30 15:55:24 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Tyr272Cys' Q16637:p.Ser266Pro S266P mutation disrupting strength mutation disrupting interaction strength mutation disrupting strength substitut analysis substitution analysis substitut analysis certain certain sequence position certain certain certain sequence position certain S P This feature has been corrected as a result of our quality control procedures. The original label was 'S266P'. Wed May 02 16:32:22 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'ser266pro' Tue Jun 30 17:24:37 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Ser266Pro' Q16637:p.Met263Arg M263R/T mutation disrupting strength mutation disrupting interaction strength mutation disrupting strength substitut analysis substitution analysis substitut analysis certain certain sequence position certain certain certain sequence position certain M R Wed May 02 18:44:57 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'met263arg' Tue Jun 30 18:34:31 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Met263Arg' Q16637:p.Leu260Ser L260S mutation disrupting strength mutation disrupting interaction strength mutation disrupting strength substitut analysis substitution analysis substitut analysis certain certain sequence position certain certain certain sequence position certain L S This feature has been corrected as a result of our quality control procedures. The original label was 'L260S'. Wed May 02 19:52:05 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'leu260ser' Tue Jun 30 16:49:26 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Leu260Ser' Q16637:p.Thr274Ala T274A mutation disrupting strength mutation disrupting interaction strength mutation disrupting strength alanine scanning alanine scanning certain certain sequence position certain certain certain sequence position certain T A This feature has been corrected as a result of our quality control procedures. The original label was 'T274A'. Wed May 02 19:06:16 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'thr274ala' Tue Jun 30 17:01:41 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Thr274Ala' Q16637:p.Gly271Ala G271A mutation disrupting strength mutation disrupting interaction strength mutation disrupting strength alanine scanning alanine scanning certain certain sequence position certain certain certain sequence position certain G A This feature has been corrected as a result of our quality control procedures. The original label was 'G271A'. Wed May 02 19:59:01 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'gly271ala' Tue Jun 30 17:39:18 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Gly271Ala' Q16637:p.Gly275Ala G275A mutation disrupting strength mutation disrupting interaction strength mutation disrupting strength alanine scanning alanine scanning certain certain sequence position certain certain certain sequence position certain G A This feature has been corrected as a result of our quality control procedures. The original label was 'G275A'. Wed May 02 20:06:40 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'gly275ala' Tue Jun 30 20:05:50 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Gly275Ala' Q16637:p.Tyr268Ala Y268A mutation disrupting strength mutation disrupting interaction strength mutation disrupting strength alanine scanning alanine scanning certain certain sequence position certain certain certain sequence position certain Y A This feature has been corrected as a result of our quality control procedures. The original label was 'Y268A'. Wed May 02 18:07:01 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'tyr268ala' Tue Jun 30 17:47:14 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Tyr268Ala' Q16637:p.Trp267Ala W267A mutation disrupting strength mutation disrupting interaction strength mutation disrupting strength alanine scanning alanine scanning certain certain sequence position certain certain certain sequence position certain W A This feature has been corrected as a result of our quality control procedures. The original label was 'W267A'. Wed May 02 19:09:08 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'trp267ala' Tue Jun 30 19:21:13 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Trp267Ala' Q16637:p.Met263Ala M263A mutation disrupting strength mutation disrupting interaction strength mutation disrupting strength alanine scanning alanine scanning certain certain sequence position certain certain certain sequence position certain M A This feature has been corrected as a result of our quality control procedures. The original label was 'M263A'. Wed May 02 16:00:14 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'met263ala' Tue Jun 30 18:45:37 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Met263Ala' Q16637:p.Leu264Ala L264A mutation disrupting strength mutation disrupting interaction strength mutation disrupting strength alanine scanning alanine scanning certain certain sequence position certain certain certain sequence position certain L A This feature has been corrected as a result of our quality control procedures. The original label was 'L264A'. Wed May 02 15:03:00 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'leu264ala' Tue Jun 30 16:56:26 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Leu264Ala' Q16637:p.Tyr272Ala Y272A mutation disrupting strength mutation disrupting interaction strength mutation disrupting strength alanine scanning alanine scanning certain certain sequence position certain certain certain sequence position certain Y A This feature has been corrected as a result of our quality control procedures. The original label was 'Y272A'. Wed May 02 18:32:54 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'tyr272ala' Tue Jun 30 17:01:45 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Tyr272Ala' Q16637:p.Thr274Ile T274I mutation decreasing strength mutation decreasing interaction strength mutation decreasing strength substitut analysis substitution analysis substitut analysis certain certain sequence position certain certain certain sequence position certain T I This feature has been corrected as a result of our quality control procedures. The original label was 'T274I'. Wed May 02 16:52:44 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'thr274ile' Tue Jun 30 16:23:34 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Thr274Ile' Q16637:p.Tyr276Ala Y276A mutation decreasing strength mutation decreasing interaction strength mutation decreasing strength alanine scanning alanine scanning certain certain sequence position certain certain certain sequence position certain Y A This feature has been corrected as a result of our quality control procedures. The original label was 'Y276A'. Wed May 02 18:17:58 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'tyr276ala' Tue Jun 30 16:13:50 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Tyr276Ala' Q16637:p.Tyr277Ala Y277A mutation decreasing strength mutation decreasing interaction strength mutation decreasing strength alanine scanning alanine scanning certain certain sequence position certain certain certain sequence position certain Y A This feature has been corrected as a result of our quality control procedures. The original label was 'Y277A'. Wed May 02 16:09:26 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'tyr277ala' Tue Jun 30 17:18:05 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Tyr277Ala' Q16637:p.Met269Ala M269A mutation decreasing strength mutation decreasing interaction strength mutation decreasing strength alanine scanning alanine scanning certain certain sequence position certain certain certain sequence position certain M A This feature has been corrected as a result of our quality control procedures. The original label was 'M269A'. Wed May 02 15:04:45 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'met269ala' Tue Jun 30 18:54:32 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Met269Ala' Q16637:p.Met263Thr mutation disrupting strength mutation disrupting interaction strength mutation disrupting strength certain certain sequence position certain certain certain sequence position certain M T Wed May 02 15:49:57 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'met263thr' Tue Jun 30 17:30:26 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Met263Thr' ecolx Escherichia coli direct interaction direct interaction smn1-7 3 11 unspecified role unspecified role unspecified role unspecified role Region 263-294 Region 263-294 sufficient to bind sufficient binding region sufficient to bind deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain MBP-tag MBP-tag mbp tag maltose binding protein tag maltose binding protein tag maltose binding protein tag mbp tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range ecolx Escherichia coli direct interaction direct interaction