DIP Database of Interacting Proteins 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ dip@mbi.ucla.edu Folate binding site of flavin-dependent thymidylate synthase. Folate binding site of flavin-dependent thymidylate synthase. Proceedings of the National Academy of Sciences of the United States of America 2012 imex curation Koehn EM., Perissinotti LL., Moghram S., Prabhakar A., Lesley SA., Mathews II., Kohen A. Only protein-protein interactions ecolx Escherichia coli x-ray diffraction x-ray crystallography X-ray X-ray x-ray diffraction predetermined predetermined participant predetermined Koehn EM., Perissinotti LL., Moghram S., Prabhakar A., Lesley SA., Mathews II., Kohen A. DIP original experiment: DIP-251794X Proceedings of the National Academy of Sciences of the United States of America 2012 IMEx Folate binding site of flavin-dependent thymidylate synthase. thyx_thema Flavin-dependent thymidylate synthase thyX thy1 TM_0449 FAD-dependent thymidylate synthase Thymidylate synthase ThyX protein protein thema Thermotoga maritima (strain ATCC 43589 / MSB8 / DSM 3109 / JCM 10099) MKIDILDKGFVELVDVMGNDLSAVRAARVSFDMGLKDEERDRHLIEYLMKHGHETPFEHIVFTFHVKAPIFVARQWFRHRIASYNELSGRYSKLSYEFYIPSPERLEGYKTTIPPERVTEKISEIVDKAYRTYLELIESGVPREVARIVLPLNLYTRFFWTVNARSLMNFLNLRADSHAQWEIQQYALAIARIFKEKCPWTFEAFLKYAYKGDILKEVQV DIP protein Q9WYT0 original sequence version: 86 thyx-1 1 2 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli direct interaction direct interaction