DIP Database of Interacting Proteins 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ dip@mbi.ucla.edu Solution conformations of prototype foamy virus integrase and its stable synaptic complex with U5 viral DNA. Solution conformations of prototype foamy virus integrase and its stable synaptic complex with U5 viral DNA. Structure (London, England : 1993) 2012 imex curation Gupta K., Curtis JE., Krueger S., Hwang Y., Cherepanov P., Bushman FD., Van Duyne GD. Only protein-protein interactions in vitro In vitro dls dynamic light scattering dls predetermined predetermined participant predetermined Gupta K., Curtis JE., Krueger S., Hwang Y., Cherepanov P., Bushman FD., Van Duyne GD. DIP original experiment: DIP-252367X Structure (London, England : 1993) 2012 IMEx Solution conformations of prototype foamy virus integrase and its stable synaptic complex with U5 viral DNA. Solution conformations of prototype foamy virus integrase and its stable synaptic complex with U5 viral DNA. Solution conformations of prototype foamy virus integrase and its stable synaptic complex with U5 viral DNA. Structure (London, England : 1993) 2012 imex curation Gupta K., Curtis JE., Krueger S., Hwang Y., Cherepanov P., Bushman FD., Van Duyne GD. Only protein-protein interactions in vitro In vitro light scattering light scattering predetermined predetermined participant predetermined Gupta K., Curtis JE., Krueger S., Hwang Y., Cherepanov P., Bushman FD., Van Duyne GD. DIP original experiment: DIP-252363X Structure (London, England : 1993) 2012 IMEx Solution conformations of prototype foamy virus integrase and its stable synaptic complex with U5 viral DNA. Solution conformations of prototype foamy virus integrase and its stable synaptic complex with U5 viral DNA. Solution conformations of prototype foamy virus integrase and its stable synaptic complex with U5 viral DNA. Structure (London, England : 1993) 2012 imex curation Gupta K., Curtis JE., Krueger S., Hwang Y., Cherepanov P., Bushman FD., Van Duyne GD. Only protein-protein interactions in vitro In vitro solution sedimentati cosedimentation in solution solution sedimentati predetermined predetermined participant predetermined Gupta K., Curtis JE., Krueger S., Hwang Y., Cherepanov P., Bushman FD., Van Duyne GD. DIP original experiment: DIP-252364X Structure (London, England : 1993) 2012 IMEx Solution conformations of prototype foamy virus integrase and its stable synaptic complex with U5 viral DNA. Solution conformations of prototype foamy virus integrase and its stable synaptic complex with U5 viral DNA. Solution conformations of prototype foamy virus integrase and its stable synaptic complex with U5 viral DNA. Structure (London, England : 1993) 2012 imex curation Gupta K., Curtis JE., Krueger S., Hwang Y., Cherepanov P., Bushman FD., Van Duyne GD. Only protein-protein interactions in vitro In vitro sans small angle neutron scattering SANS SANS sans predetermined predetermined participant predetermined Gupta K., Curtis JE., Krueger S., Hwang Y., Cherepanov P., Bushman FD., Van Duyne GD. DIP original experiment: DIP-252366X Structure (London, England : 1993) 2012 IMEx Solution conformations of prototype foamy virus integrase and its stable synaptic complex with U5 viral DNA. Solution conformations of prototype foamy virus integrase and its stable synaptic complex with U5 viral DNA. Solution conformations of prototype foamy virus integrase and its stable synaptic complex with U5 viral DNA. Structure (London, England : 1993) 2012 imex curation Gupta K., Curtis JE., Krueger S., Hwang Y., Cherepanov P., Bushman FD., Van Duyne GD. Only protein-protein interactions in vitro In vitro saxs x ray scattering saxs predetermined predetermined participant predetermined Gupta K., Curtis JE., Krueger S., Hwang Y., Cherepanov P., Bushman FD., Van Duyne GD. DIP original experiment: DIP-252365X Structure (London, England : 1993) 2012 IMEx Solution conformations of prototype foamy virus integrase and its stable synaptic complex with U5 viral DNA. Solution conformations of prototype foamy virus integrase and its stable synaptic complex with U5 viral DNA. Solution conformations of prototype foamy virus integrase and its stable synaptic complex with U5 viral DNA. Structure (London, England : 1993) 2012 imex curation Gupta K., Curtis JE., Krueger S., Hwang Y., Cherepanov P., Bushman FD., Van Duyne GD. Only protein-protein interactions in vitro In vitro molecular sieving molecular sieving Gel Filtration Size Exclusion Chromatography Size Exclusion Chromatography Gel Filtration Sizing column predetermined predetermined participant predetermined Gupta K., Curtis JE., Krueger S., Hwang Y., Cherepanov P., Bushman FD., Van Duyne GD. DIP original experiment: DIP-252362X Structure (London, England : 1993) 2012 IMEx Solution conformations of prototype foamy virus integrase and its stable synaptic complex with U5 viral DNA. pro_0000245446 Integrase pol protein protein foamv Human spumaretrovirus SFVcpz(hu) Human foamy virus CNTKKPNLDAELDQLLQGHYIKGYPKQYTYFLEDGKVKVSRPEGVKIIPPQSDRQKIVLQAHNLAHTGREATLLKIANLYWWPNMRKDVVKQLGRCQQCLITNASNKASGPILRPDRPQKPFDKFFIDYIGPLPPSQGYLYVLVVVDGMTGFTWLYPTKAPSTSATVKSLNVLTSIAIPKVIHSDQGAAFTSSTFAEWAKERGIHLEFSTPYHPQSGSKVERKNSDIKRLLTKLLVGRPTKWYDLLPVVQLALNNTYSPVLKYTPHQLLFGIDSNTPFANQDTLDLTREEELSLLQEIRTSLYHPSTPPASSRSWSPVVGQLVQERVARPASLRPRWHKPSTVLKVLNPRTVVILDHLGNNRTVSIDNLKPTSHQNGTTNDTATMDHLEKNE DIP protein P14350-PRO_0000245446 original sequence version: 108 pol-6 6 7 unspecified role unspecified role unspecified role unspecified role Integrase sununit Region 752-1143 polyprotein frag polyprotein fragment polyprotein frag certain certain sequence position certain certain certain sequence position certain Out of date range Feature range: Line: 143, Character: 10: This range position is out of bounds. Actual position : (752-752), sequence length: 392, This range position is out of bounds. Actual position : (1143-1143), sequence length: 392 ecolx Escherichia coli direct interaction direct interaction pol-7 5 7 unspecified role unspecified role unspecified role unspecified role Integrase sununit Region 752-1143 polyprotein frag polyprotein fragment polyprotein frag certain certain sequence position certain certain certain sequence position certain Out of date range Feature range: Line: 307, Character: 10: This range position is out of bounds. Actual position : (752-752), sequence length: 392, This range position is out of bounds. Actual position : (1143-1143), sequence length: 392 ecolx Escherichia coli direct interaction direct interaction pol-8 4 7 unspecified role unspecified role unspecified role unspecified role Integrase sununit Region 752-1143 polyprotein frag polyprotein fragment polyprotein frag certain certain sequence position certain certain certain sequence position certain Out of date range Feature range: Line: 471, Character: 10: This range position is out of bounds. Actual position : (752-752), sequence length: 392, This range position is out of bounds. Actual position : (1143-1143), sequence length: 392 ecolx Escherichia coli direct interaction direct interaction pol-9 2 7 unspecified role unspecified role unspecified role unspecified role Integrase sununit Region 752-1143 polyprotein frag polyprotein fragment polyprotein frag certain certain sequence position certain certain certain sequence position certain Out of date range Feature range: Line: 635, Character: 10: This range position is out of bounds. Actual position : (752-752), sequence length: 392, This range position is out of bounds. Actual position : (1143-1143), sequence length: 392 ecolx Escherichia coli direct interaction direct interaction pol-10 3 7 unspecified role unspecified role unspecified role unspecified role Integrase sununit Region 752-1143 polyprotein frag polyprotein fragment polyprotein frag certain certain sequence position certain certain certain sequence position certain Out of date range Feature range: Line: 799, Character: 10: This range position is out of bounds. Actual position : (752-752), sequence length: 392, This range position is out of bounds. Actual position : (1143-1143), sequence length: 392 ecolx Escherichia coli direct interaction direct interaction pol-11 1 7 unspecified role unspecified role unspecified role unspecified role Integrase sununit Region 752-1143 polyprotein frag polyprotein fragment polyprotein frag certain certain sequence position certain certain certain sequence position certain Out of date range Feature range: Line: 963, Character: 10: This range position is out of bounds. Actual position : (752-752), sequence length: 392, This range position is out of bounds. Actual position : (1143-1143), sequence length: 392 ecolx Escherichia coli direct interaction direct interaction