DIP Database of Interacting Proteins 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ dip@mbi.ucla.edu TIPE2 protein serves as a negative regulator of phagocytosis and oxidative burst during infection. TIPE2 protein serves as a negative regulator of phagocytosis and oxidative burst during infection. Proceedings of the National Academy of Sciences of the United States of America 2012 imex curation Wang Z., Fayngerts S., Wang P., Sun H., Johnson DS., Ruan Q., Guo W., Chen YH. Only protein-protein interactions human Homo sapiens Human anti tag coip anti tag coimmunoprecipitation anti tag coip anti tag western anti tag western blot anti tag western Wang Z., Fayngerts S., Wang P., Sun H., Johnson DS., Ruan Q., Guo W., Chen YH. DIP original experiment: DIP-253597X Proceedings of the National Academy of Sciences of the United States of America 2012 IMEx TIPE2 protein serves as a negative regulator of phagocytosis and oxidative burst during infection. TIPE2 protein serves as a negative regulator of phagocytosis and oxidative burst during infection. TIPE2 protein serves as a negative regulator of phagocytosis and oxidative burst during infection. Proceedings of the National Academy of Sciences of the United States of America 2012 imex curation Wang Z., Fayngerts S., Wang P., Sun H., Johnson DS., Ruan Q., Guo W., Chen YH. Only protein-protein interactions human Homo sapiens Human anti tag coip anti tag coimmunoprecipitation anti tag coip anti tag western anti tag western blot anti tag western Wang Z., Fayngerts S., Wang P., Sun H., Johnson DS., Ruan Q., Guo W., Chen YH. DIP original experiment: DIP-253602X Proceedings of the National Academy of Sciences of the United States of America 2012 IMEx TIPE2 protein serves as a negative regulator of phagocytosis and oxidative burst during infection. TIPE2 protein serves as a negative regulator of phagocytosis and oxidative burst during infection. TIPE2 protein serves as a negative regulator of phagocytosis and oxidative burst during infection. Proceedings of the National Academy of Sciences of the United States of America 2012 imex curation Wang Z., Fayngerts S., Wang P., Sun H., Johnson DS., Ruan Q., Guo W., Chen YH. Only protein-protein interactions human Homo sapiens Human anti tag coip anti tag coimmunoprecipitation anti tag coip anti tag western anti tag western blot anti tag western Wang Z., Fayngerts S., Wang P., Sun H., Johnson DS., Ruan Q., Guo W., Chen YH. DIP original experiment: DIP-253596X Proceedings of the National Academy of Sciences of the United States of America 2012 IMEx TIPE2 protein serves as a negative regulator of phagocytosis and oxidative burst during infection. TIPE2 protein serves as a negative regulator of phagocytosis and oxidative burst during infection. TIPE2 protein serves as a negative regulator of phagocytosis and oxidative burst during infection. Proceedings of the National Academy of Sciences of the United States of America 2012 imex curation Wang Z., Fayngerts S., Wang P., Sun H., Johnson DS., Ruan Q., Guo W., Chen YH. Only protein-protein interactions in vitro In vitro anti tag coip anti tag coimmunoprecipitation anti tag coip anti tag western anti tag western blot anti tag western Wang Z., Fayngerts S., Wang P., Sun H., Johnson DS., Ruan Q., Guo W., Chen YH. DIP original experiment: DIP-253600X Proceedings of the National Academy of Sciences of the United States of America 2012 IMEx TIPE2 protein serves as a negative regulator of phagocytosis and oxidative burst during infection. TIPE2 protein serves as a negative regulator of phagocytosis and oxidative burst during infection. TIPE2 protein serves as a negative regulator of phagocytosis and oxidative burst during infection. Proceedings of the National Academy of Sciences of the United States of America 2012 imex curation Wang Z., Fayngerts S., Wang P., Sun H., Johnson DS., Ruan Q., Guo W., Chen YH. Only protein-protein interactions human Homo sapiens Human anti tag coip anti tag coimmunoprecipitation anti tag coip anti tag western anti tag western blot anti tag western Wang Z., Fayngerts S., Wang P., Sun H., Johnson DS., Ruan Q., Guo W., Chen YH. DIP original experiment: DIP-253595X Proceedings of the National Academy of Sciences of the United States of America 2012 IMEx TIPE2 protein serves as a negative regulator of phagocytosis and oxidative burst during infection. TIPE2 protein serves as a negative regulator of phagocytosis and oxidative burst during infection. TIPE2 protein serves as a negative regulator of phagocytosis and oxidative burst during infection. Proceedings of the National Academy of Sciences of the United States of America 2012 imex curation Wang Z., Fayngerts S., Wang P., Sun H., Johnson DS., Ruan Q., Guo W., Chen YH. Only protein-protein interactions human Homo sapiens Human anti tag coip anti tag coimmunoprecipitation anti tag coip anti tag western anti tag western blot anti tag western Wang Z., Fayngerts S., Wang P., Sun H., Johnson DS., Ruan Q., Guo W., Chen YH. DIP original experiment: DIP-253601X Proceedings of the National Academy of Sciences of the United States of America 2012 IMEx TIPE2 protein serves as a negative regulator of phagocytosis and oxidative burst during infection. TIPE2 protein serves as a negative regulator of phagocytosis and oxidative burst during infection. TIPE2 protein serves as a negative regulator of phagocytosis and oxidative burst during infection. Proceedings of the National Academy of Sciences of the United States of America 2012 imex curation Wang Z., Fayngerts S., Wang P., Sun H., Johnson DS., Ruan Q., Guo W., Chen YH. Only protein-protein interactions in vitro In vitro anti tag coip anti tag coimmunoprecipitation anti tag coip autoradiography autoradiography Wang Z., Fayngerts S., Wang P., Sun H., Johnson DS., Ruan Q., Guo W., Chen YH. DIP original experiment: DIP-253599X Proceedings of the National Academy of Sciences of the United States of America 2012 IMEx TIPE2 protein serves as a negative regulator of phagocytosis and oxidative burst during infection. TIPE2 protein serves as a negative regulator of phagocytosis and oxidative burst during infection. TIPE2 protein serves as a negative regulator of phagocytosis and oxidative burst during infection. Proceedings of the National Academy of Sciences of the United States of America 2012 imex curation Wang Z., Fayngerts S., Wang P., Sun H., Johnson DS., Ruan Q., Guo W., Chen YH. Only protein-protein interactions human Homo sapiens Human anti tag coip anti tag coimmunoprecipitation anti tag coip anti tag western anti tag western blot anti tag western Wang Z., Fayngerts S., Wang P., Sun H., Johnson DS., Ruan Q., Guo W., Chen YH. DIP original experiment: DIP-253598X Proceedings of the National Academy of Sciences of the United States of America 2012 IMEx TIPE2 protein serves as a negative regulator of phagocytosis and oxidative burst during infection. rac2_human Ras-related C3 botulinum toxin substrate 2 p21-Rac2 Small G protein GX RAC2 protein protein human Homo sapiens Human MQAIKCVVVGDGAVGKTCLLISYTTNAFPGEYIPTVFDNYSANVMVDSKPVNLGLWDTAGQEDYDRLRPLSYPQTDVFLICFSLVSPASYENVRAKWFPEVRHHCPSTPIILVGTKLDLRDDKDTIEKLKEKKLAPITYPQGLALAKEIDSVKYLECSALTQRGLKTVFDEAIRAVLCPQPTRQQKRACSLL DIP protein P15153 original sequence version: 154 DIP protein P15153 original sequence version: 153 DIP protein P15153 original sequence version: 123 2A1F1266B07C3210 tp8l2_human Tumor necrosis factor alpha-induced protein 8-like protein 2 TNFAIP8L2 Inflammation factor protein 20 protein protein human Homo sapiens Human MESFSSKSLALQAEKKLLSKMAGRSVAHLFIDETSSEVLDELYRVSKEYTHSRPQAQRVIKDLIKVAIKVAVLHRNGSFGPSELALATRFRQKLRQGAMTALSFGEVDFTFEAAVLAGLLTECRDVLLELVEHHLTPKSHGRIRHVFDHFSDPGLLTALYGPDFTQHLGKICDGLRKLLDEGKL DIP protein Q6P589 original sequence version: 80 D76EAEF5E24D3895 p63000-1 Ras-related C3 botulinum toxin substrate 1 RAC1 Cell migration-inducing gene 5 protein Ras-like protein TC25 TC25 p21-Rac1 MIG5 Rac1A protein protein human Homo sapiens Human MQAIKCVVVGDGAVGKTCLLISYTTNAFPGEYIPTVFDNYSANVMVDGKPVNLGLWDTAGQEDYDRLRPLSYPQTDVFLICFSLVSPASFENVRAKWYPEVRHHCPNTPIILVGTKLDLRDDKDTIEKLKEKKLTPITYPQGLAMAKEIGAVKYLECSALTQRGLKTVFDEAIRAVLCPPPVKKRKRKCLLL DIP protein P63000-1 original sequence version: 44 DIP protein P63000 original sequence version: 133 DIP protein P63000-1 original sequence version: 128 DIP protein P63000 original sequence version: 90 DIP protein P63000 original sequence version: 91 DIP protein P63000 original sequence version: 92 DIP protein P63000 original sequence version: 80 DIP protein P63000 original sequence version: 106 DIP protein P63000 original sequence version: 95 DIP protein P63000 original sequence version: 112 DIP protein P63000 original sequence version: 128 DIP protein P63000 original sequence version: 137 DIP protein P63000 original sequence version: 157 DIP protein P63000 original sequence version: 116 DIP protein P63000-1 original sequence version: 124 mint ACEDF83A45E5EA67 tnfaip8l2-rac2-1 1 9 unspecified role unspecified role prey prey Myc-tag Myc-tag myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range human Homo sapiens Human 10 unspecified role unspecified role bait bait Flag-tag Flag-tag flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged n-term range n-terminal range n-term range n-term range n-terminal range n-term range human Homo sapiens Human physical association physical association tnfaip8l2-rac1-1 5 11 unspecified role unspecified role prey prey Myc-tag Myc-tag myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range human Homo sapiens Human 10 unspecified role unspecified role bait bait Flag-tag Flag-tag flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged n-term range n-terminal range n-term range n-term range n-terminal range n-term range human Homo sapiens Human physical association physical association tnfaip8l2-rac1-2 6 11 unspecified role unspecified role prey prey HA-tag HA-tag ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range Region 162-192 Region 162-192 required to bind necessary binding region required to bind deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain P63000-1:p.Cys189Ser C189S mutation disrupting strength mutation disrupting interaction strength mutation disrupting strength substitut analysis substitution analysis substitut analysis certain certain sequence position certain certain certain sequence position certain C S This feature has been corrected as a result of our quality control procedures. The original label was 'C189S'. Wed May 02 14:30:18 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'cys189ser' Tue Jun 30 19:45:23 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Cys189Ser' human Homo sapiens Human 10 unspecified role unspecified role bait bait Flag-tag Flag-tag flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged n-term range n-terminal range n-term range n-term range n-terminal range n-term range human Homo sapiens Human physical association physical association tnfaip8l2-rac1-3 7 11 unspecified role unspecified role prey prey 35S-label 35S-label 35s radiolabel 35s radiolabel 35S s35 radiolabelled S35 s35 radiolabelled 35S S35 undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined in vitro In vitro 10 unspecified role unspecified role bait bait Flag-tag Flag-tag flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged n-term range n-terminal range n-term range n-term range n-terminal range n-term range in vitro In vitro direct interaction direct interaction rac2-tnfaip8l2-1 8 9 unspecified role unspecified role bait bait Myc-tag Myc-tag myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range human Homo sapiens Human 10 unspecified role unspecified role prey prey Flag-tag Flag-tag flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged n-term range n-terminal range n-term range n-term range n-terminal range n-term range human Homo sapiens Human physical association physical association tnfaip8l2-rac1-4 2 11 unspecified role unspecified role prey prey HA-tag HA-tag ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range human Homo sapiens Human 10 unspecified role unspecified role bait bait Flag-tag Flag-tag flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged n-term range n-terminal range n-term range n-term range n-terminal range n-term range Q6P589:p.[Lys15Gln;Lys16Gln] K15Q/K16Q mutation decreasing strength mutation decreasing interaction strength mutation decreasing strength substitut analysis substitution analysis substitut analysis certain certain sequence position certain certain certain sequence position certain K Q certain certain sequence position certain certain certain sequence position certain K Q This feature has been corrected as a result of our quality control procedures. The original label was 'K15Q/K16Q'. Wed May 02 17:47:56 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'lys15gln,lys16gln' Tue Jun 30 15:40:09 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.[Lys15Gln;Lys16Gln]' Q6P589:p.Arg24Ala R24A mutation disrupting strength mutation disrupting interaction strength mutation disrupting strength alanine scanning alanine scanning certain certain sequence position certain certain certain sequence position certain R A This feature has been corrected as a result of our quality control procedures. The original label was 'R24A'. Wed May 02 17:16:47 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'arg24ala' Tue Jun 30 16:36:48 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Arg24Ala' human Homo sapiens Human physical association physical association rac1-tnfaip8l2-1 3 11 unspecified role unspecified role bait bait Myc-tag Myc-tag myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range human Homo sapiens Human 10 unspecified role unspecified role prey prey Flag-tag Flag-tag flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged n-term range n-terminal range n-term range n-term range n-terminal range n-term range human Homo sapiens Human physical association physical association rac1-tnfaip8l2-2 4 11 unspecified role unspecified role bait bait Myc-tag Myc-tag myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range in vitro In vitro 10 unspecified role unspecified role prey prey 35S-label 35S-label 35s radiolabel 35s radiolabel 35S s35 radiolabelled S35 s35 radiolabelled 35S S35 undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined in vitro In vitro direct interaction direct interaction