DIP Database of Interacting Proteins 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ dip@mbi.ucla.edu Self-regulation of the head-inducing properties of the Spemann organizer. Self-regulation of the head-inducing properties of the Spemann organizer. Proceedings of the National Academy of Sciences of the United States of America 2012 imex curation Inui M., Montagner M., Ben-Zvi D., Martello G., Soligo S., Manfrin A., Aragona M., Enzo E., Zacchigna L., Zanconato F., Azzolin L., Dupont S., Cordenonsi M., Piccolo S. Only protein-protein interactions in vitro In vitro pull down pull down anti tag western anti tag western blot anti tag western Inui M., Montagner M., Ben-Zvi D., Martello G., Soligo S., Manfrin A., Aragona M., Enzo E., Zacchigna L., Zanconato F., Azzolin L., Dupont S., Cordenonsi M., Piccolo S. DIP original experiment: DIP-251786X Proceedings of the National Academy of Sciences of the United States of America 2012 IMEx Self-regulation of the head-inducing properties of the Spemann organizer. Self-regulation of the head-inducing properties of the Spemann organizer. Self-regulation of the head-inducing properties of the Spemann organizer. Proceedings of the National Academy of Sciences of the United States of America 2012 imex curation Inui M., Montagner M., Ben-Zvi D., Martello G., Soligo S., Manfrin A., Aragona M., Enzo E., Zacchigna L., Zanconato F., Azzolin L., Dupont S., Cordenonsi M., Piccolo S. Only protein-protein interactions in vitro In vitro pull down pull down predetermined predetermined participant predetermined Inui M., Montagner M., Ben-Zvi D., Martello G., Soligo S., Manfrin A., Aragona M., Enzo E., Zacchigna L., Zanconato F., Azzolin L., Dupont S., Cordenonsi M., Piccolo S. DIP original experiment: DIP-251787X Proceedings of the National Academy of Sciences of the United States of America 2012 IMEx Self-regulation of the head-inducing properties of the Spemann organizer. p27037-1 Activin receptor type-2A ACVR2A ACVR2 Activin receptor type IIA protein protein human Homo sapiens Human MGAAAKLAFAVFLISCSSGAILGRSETQECLFFNANWEKDRTNQTGVEPCYGDKDKRRHCFATWKNISGSIEIVKQGCWLDDINCYDRTDCVEKKDSPEVYFCCCEGNMCNEKFSYFPEMEVTQPTSNPVTPKPPYYNILLYSLVPLMLIAGIVICAFWVYRHHKMAYPPVLVPTQDPGPPPPSPLLGLKPLQLLEVKARGRFGCVWKAQLLNEYVAVKIFPIQDKQSWQNEYEVYSLPGMKHENILQFIGAEKRGTSVDVDLWLITAFHEKGSLSDFLKANVVSWNELCHIAETMARGLAYLHEDIPGLKDGHKPAISHRDIKSKNVLLKNNLTACIADFGLALKFEAGKSAGDTHGQVGTRRYMAPEVLEGAINFQRDAFLRIDMYAMGLVLWELASRCTAADGPVDEYMLPFEEEIGQHPSLEDMQEVVVHKKKRPVLRDYWQKHAGMAMLCETIEECWDHDAEARLSAGCVGERITQMQRLTNIITTEDIVTVVTMVTNVDFPPKESSL DIP protein P27037-1 original sequence version: 164 DIP protein P27037 original sequence version: 140 q9pvk1_chick ADMP protein protein chick Gallus gallus (Chicken) Chicken MLGTVLLLLLALARPAAPESRRAEALKKLLEVFGMEDPPPPPAHVKQPPQYMVDLFNAVANADGVTKNPDVLEGNTVRSFLDRTHGEKMRFLFVLSSVARNEKILTAELHLFRLWPRAAEGPRRHHFCQVSVYQILDESEPDSPEGQKLLATRLLSLQGSGWEVFAITQAVRDWTQDESSNRGLLVTVHGLGGSALEAPAVQFASSGDHHESKKPMLVLFTDDGRRGASLPMAGVPASQPRDFPAKLSGPRSARSLDRLQPCQRHPLSVDFEEIGWSGWIISPRGYNAYHCRGSCPFPLGENMRPTNHATVQSIINALKLSEGVSSPCCVPDKLHSINLLYFDDDENVVLKQYDDMVAGSCGCH DIP protein Q9PVK1 original sequence version: 61 acvr1_human Activin receptor type-1 Activin receptor-like kinase 2 TGF-B superfamily receptor type I ACVRLK2 Activin receptor type I Serine/threonine-protein kinase receptor R1 ACVR1 protein protein human Homo sapiens Human MVDGVMILPVLIMIALPSPSMEDEKPKVNPKLYMCVCEGLSCGNEDHCEGQQCFSSLSINDGFHVYQKGCFQVYEQGKMTCKTPPSPGQAVECCQGDWCNRNITAQLPTKGKSFPGTQNFHLEVGLIILSVVFAVCLLACLLGVALRKFKRRNQERLNPRDVEYGTIEGLITTNVGDSTLADLLDHSCTSGSGSGLPFLVQRTVARQITLLECVGKGRYGEVWRGSWQGENVAVKIFSSRDEKSWFRETELYNTVMLRHENILGFIASDMTSRHSSTQLWLITHYHEMGSLYDYLQLTTLDTVSCLRIVLSIASGLAHLHIEIFGTQGKPAIAHRDLKSKNILVKKNGQCCIADLGLAVMHSQSTNQLDVGNNPRVGTKRYMAPEVLDETIQVDCFDSYKRVDIWAFGLVLWEVARRMVSNGIVEDYKPPFYDVVPNDPSFEDMRKVVCVDQQRPNIPNRWFSDPTLTSLAKLMKECWYQNPSARLTALRIKKTLTKIDNSLDKLKTDC DIP protein Q04771 original sequence version: 138 E2B0F051D19DD052 acvr1-admp-1 1 4 unspecified role unspecified role prey prey Region 19-364 Region 19-364 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain Myc-tag Myc-tag myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range human Homo sapiens Human 5 unspecified role unspecified role bait bait Fc-tag Fc-tag fc-igg tag fc-igg tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range Region 23-124 Region 23-124 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain mouse Mus musculus Mouse physical association physical association acvr2a-admp-1 2 3 unspecified role unspecified role bait bait Region 25-134 Region 25-134 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain Fc-tag Fc-tag fc-igg tag fc-igg tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range spofr Spodoptera frugiperda (Fall armyworm) Fall armyworm 4 unspecified role unspecified role prey prey Region 19-364 Region 19-364 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain Myc-tag Myc-tag myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range human Homo sapiens Human physical association physical association