DIP Database of Interacting Proteins 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ dip@mbi.ucla.edu Structure of the haptoglobin-haemoglobin complex. Structure of the haptoglobin-haemoglobin complex. Nature 2012 imex curation Andersen CB., Torvund-Jensen M., Nielsen MJ., de Oliveira CL., Hersleth HP., Andersen NH., Pedersen JS., Andersen GR., Moestrup SK. Only protein-protein interactions in vitro In vitro x-ray diffraction x-ray crystallography X-ray X-ray x-ray diffraction predetermined predetermined participant predetermined Andersen CB., Torvund-Jensen M., Nielsen MJ., de Oliveira CL., Hersleth HP., Andersen NH., Pedersen JS., Andersen GR., Moestrup SK. DIP original experiment: DIP-250716X Nature 2012 IMEx Structure of the haptoglobin-haemoglobin complex. Structure of the haptoglobin-haemoglobin complex. Structure of the haptoglobin-haemoglobin complex. Nature 2012 imex curation Andersen CB., Torvund-Jensen M., Nielsen MJ., de Oliveira CL., Hersleth HP., Andersen NH., Pedersen JS., Andersen GR., Moestrup SK. Only protein-protein interactions in vitro In vitro saxs x ray scattering saxs predetermined predetermined participant predetermined Andersen CB., Torvund-Jensen M., Nielsen MJ., de Oliveira CL., Hersleth HP., Andersen NH., Pedersen JS., Andersen GR., Moestrup SK. DIP original experiment: DIP-250715X Nature 2012 IMEx Structure of the haptoglobin-haemoglobin complex. Structure of the haptoglobin-haemoglobin complex. Structure of the haptoglobin-haemoglobin complex. Nature 2012 imex curation Andersen CB., Torvund-Jensen M., Nielsen MJ., de Oliveira CL., Hersleth HP., Andersen NH., Pedersen JS., Andersen GR., Moestrup SK. Only protein-protein interactions in vitro In vitro molecular sieving molecular sieving Gel Filtration Size Exclusion Chromatography Size Exclusion Chromatography Gel Filtration Sizing column predetermined predetermined participant predetermined Andersen CB., Torvund-Jensen M., Nielsen MJ., de Oliveira CL., Hersleth HP., Andersen NH., Pedersen JS., Andersen GR., Moestrup SK. DIP original experiment: DIP-250714X Nature 2012 IMEx Structure of the haptoglobin-haemoglobin complex. Structure of the haptoglobin-haemoglobin complex. Structure of the haptoglobin-haemoglobin complex. Nature 2012 imex curation Andersen CB., Torvund-Jensen M., Nielsen MJ., de Oliveira CL., Hersleth HP., Andersen NH., Pedersen JS., Andersen GR., Moestrup SK. Only protein-protein interactions in vitro In vitro ion exchange chrom ion exchange chromatography IEC IEC ion exchange chrom predetermined predetermined participant predetermined Andersen CB., Torvund-Jensen M., Nielsen MJ., de Oliveira CL., Hersleth HP., Andersen NH., Pedersen JS., Andersen GR., Moestrup SK. DIP original experiment: DIP-250713X Nature 2012 IMEx Structure of the haptoglobin-haemoglobin complex. hpt_pig Haptoglobin HP protein protein pig Sus scrofa (Pig) Pig MRALGAVVALLLCGQLFAAETGNEATDATDDSCPKPPEIPKGYVEHMVRYHCQTYYKLRTAGDGVYTLDSNKQWTNKVTGEKLPECEAVCGKPKNPVDQVQRIMGGSLDAKGSFPWQAKMISHHNLTSGATLINEQWLLTTAKNLRLGHKNDTKAKDIAPTLRLYVGKKQEVEIEKVIFHPDNSTVDIGLIKLKQKVPVNERVMPICLPSKDYVNVGLVGYVSGWGRNANLNFTEHLKYVMLPVADQEKCVQYYEGSTVPEKKTPKSPVGVQPILNEHTFCAGLSKYQEDTCYGDAGSAFAVHDKDDDTWYAAGILSFDKSCRTAEYGVYVRVTSILDWIQTTIADN DIP protein Q8SPS7 original sequence version: 64 hbb_pig Hemoglobin subunit beta HBB Beta-globin Hemoglobin beta chain protein protein pig Sus scrofa (Pig) Pig MVHLSAEEKEAVLGLWGKVNVDEVGGEALGRLLVVYPWTQRFFESFGDLSNADAVMGNPKVKAHGKKVLQSFSDGLKHLDNLKGTFAKLSELHCDQLHVDPENFRLLGNVIVVVLARRLGHDFNPNVQAAFQKVVAGVANALAHKYH DIP protein P02067 original sequence version: 94 FC96A95FE14CEC93 hba_pig Hemoglobin subunit alpha HBA Hemoglobin alpha chain Alpha-globin protein protein pig Sus scrofa (Pig) Pig VLSAADKANVKAAWGKVGGQAGAHGAEALERMFLGFPTTKTYFPHFNLSHGSDQVKAHGQKVADALTKAVGHLDDLPGALSALSDLHAHKLRVDPVNFKLLSHCLLVTLAAHHPDDFNPSVHASLDKFLANVSTVLTSKYR DIP protein P01965 original sequence version: 87 95869BABB4C4EDB8 hba-hbb-12 2 5 unspecified role unspecified role unspecified role unspecified role pig Sus scrofa (Pig) Pig 7 unspecified role unspecified role unspecified role unspecified role pig Sus scrofa (Pig) Pig 6 unspecified role unspecified role unspecified role unspecified role pig Sus scrofa (Pig) Pig physical association physical association hba-hbb-13 4 5 unspecified role unspecified role unspecified role unspecified role pig Sus scrofa (Pig) Pig 7 unspecified role unspecified role unspecified role unspecified role pig Sus scrofa (Pig) Pig 6 unspecified role unspecified role unspecified role unspecified role pig Sus scrofa (Pig) Pig association association hba-hbb-14 1 5 unspecified role unspecified role unspecified role unspecified role pig Sus scrofa (Pig) Pig 7 unspecified role unspecified role unspecified role unspecified role pig Sus scrofa (Pig) Pig 6 unspecified role unspecified role unspecified role unspecified role pig Sus scrofa (Pig) Pig direct interaction direct interaction hba-hbb-15 3 5 unspecified role unspecified role unspecified role unspecified role pig Sus scrofa (Pig) Pig 7 unspecified role unspecified role unspecified role unspecified role pig Sus scrofa (Pig) Pig 6 unspecified role unspecified role unspecified role unspecified role pig Sus scrofa (Pig) Pig physical association physical association