IntAct European Bioinformatics Institute IntAct intact http://www.ebi.ac.uk/ http://www.ebi.ac.uk/intact/query/${ac} EBI-[0-9]+|IA:[0-9]+ INTerAction database (IntAct) provides an open source database and toolkit for the storage, presentation and analysis of molecular interactions. http://www.ebi.ac.uk/intact European Bioinformatics Institute; Wellcome Trust Genome Campus; Hinxton, Cambridge; CB10 1SD; United Kingdom http://www.ebi.ac.uk/intact/ The adaptor protein SAP directly associates with CD3ζ chain and regulates T cell receptor signaling. The adaptor protein SAP directly associates with CD3ζ chain and regulates T cell receptor signaling. PloS one 2011 imex curation Proust R., Bertoglio J., Gesbert F. SAP has been determined to be of Human origin based on the stated length of the molecule - "a 128 amino-acid long protein". franck.gesbert@u-psud.fr 14-Jul-2017: Contacted by IntAct-Help. Only protein-protein interactions in vitro In vitro far western blotting far western blotting Affinity blotting Affinity blotting anti tag western anti tag western blot anti tag western Proust R., Bertoglio J., Gesbert F. SAP has been determined to be of Human origin based on the stated length of the molecule - "a 128 amino-acid long protein". franck.gesbert@u-psud.fr Accepted 2017-JUN-26 AT 10:53 BST AT 10:53 BST by ORCHARD PloS one 2011 imex curation altered; altered The adaptor protein SAP directly associates with CD3ζ chain and regulates T cell receptor signaling. The adaptor protein SAP directly associates with CD3ζ chain and regulates T cell receptor signaling. PloS one 2011 imex curation Proust R., Bertoglio J., Gesbert F. SAP has been determined to be of Human origin based on the stated length of the molecule - "a 128 amino-acid long protein". franck.gesbert@u-psud.fr 14-Jul-2017: Contacted by IntAct-Help. Only protein-protein interactions in vitro In vitro pull down pull down western blot western blot Immuno blot Immuno blot Proust R., Bertoglio J., Gesbert F. SAP has been determined to be of Human origin based on the stated length of the molecule - "a 128 amino-acid long protein". franck.gesbert@u-psud.fr Accepted 2017-JUN-26 AT 10:53 BST AT 10:53 BST by ORCHARD PloS one 2011 imex curation altered; altered The adaptor protein SAP directly associates with CD3ζ chain and regulates T cell receptor signaling. The adaptor protein SAP directly associates with CD3ζ chain and regulates T cell receptor signaling. PloS one 2011 imex curation Proust R., Bertoglio J., Gesbert F. SAP has been determined to be of Human origin based on the stated length of the molecule - "a 128 amino-acid long protein". franck.gesbert@u-psud.fr 14-Jul-2017: Contacted by IntAct-Help. Only protein-protein interactions human-jurkat Homo sapiens jurkat Human T cell leukemia anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Proust R., Bertoglio J., Gesbert F. SAP has been determined to be of Human origin based on the stated length of the molecule - "a 128 amino-acid long protein". franck.gesbert@u-psud.fr Accepted 2017-JUN-26 AT 10:53 BST AT 10:53 BST by ORCHARD PloS one 2011 imex curation altered; altered The adaptor protein SAP directly associates with CD3ζ chain and regulates T cell receptor signaling. The adaptor protein SAP directly associates with CD3ζ chain and regulates T cell receptor signaling. PloS one 2011 imex curation Proust R., Bertoglio J., Gesbert F. SAP has been determined to be of Human origin based on the stated length of the molecule - "a 128 amino-acid long protein". franck.gesbert@u-psud.fr 14-Jul-2017: Contacted by IntAct-Help. Only protein-protein interactions in vitro In vitro pull down pull down anti tag western anti tag western blot anti tag western Proust R., Bertoglio J., Gesbert F. SAP has been determined to be of Human origin based on the stated length of the molecule - "a 128 amino-acid long protein". franck.gesbert@u-psud.fr Accepted 2017-JUN-26 AT 10:53 BST AT 10:53 BST by ORCHARD PloS one 2011 imex curation altered; altered sh21a_human SH2 domain-containing protein 1A SH2D1A DSHP SAP Signaling lymphocytic activation molecule-associated protein T-cell signal transduction molecule SAP Duncan disease SH2-protein protein protein human Homo sapiens Human MDAVAVYHGKISRETGEKLLLATGLDGSYLLRDSESVPGVYCLCVLYHGYIYTYRVSQTETGSWSAETAPGVHKRYFRKIKNLISAFQKPDQGIVIPLQYPVEKKSSARSTQGTTGIREDPDVCLKAP mint Inhibitor of the SLAM self-association. Acts by blocking recruitment of the SH2-domain-containing signal-transduction molecule SHP-2 to a docking site in the slam cytoplasmic region Defects in SH2D1A are a cause of lymphoproliferative syndrome X-linked type 1 (XLP1) [MIM:308240]; also known as X-linked lymphoproliferative disease (XLPD) or Duncan disease. XLP is a rare immunodeficiency characterized by extreme susceptibility to infection with Epstein-Barr virus (EBV). Symptoms include severe or fatal mononucleosis, acquired hypogammaglobulinemia, pancytopenia and malignant lymphoma 90234E7A6614EE3D cd3z_human T-cell surface glycoprotein CD3 zeta chain T-cell receptor T3 zeta chain CD247 CD3Z T3Z TCRZ protein protein human Homo sapiens Human MKWKALFTAAILQAQLPITEAQSFGLLDPKLCYLLDGILFIYGVILTALFLRVKFSRSADAPAYQQGQNQLYNELNLGRREEYDVLDKRRGRDPEMGGKPQRRKNPQEGLYNELQKDKMAEAYSEIGMKGERRRGKGHDGLYQGLSTATKDTYDALHMQALPPR 9408260374856EE9 slaf6_human SLAM family member 6 KALI SLAMF6 Activating NK receptor NK-T-B-antigen UNQ6123/PRO20080 protein protein human Homo sapiens Human MLWLFQSLLFVFCFGPGNVVSQSSLTPLMVNGILGESVTLPLEFPAGEKVNFITWLFNETSLAFIVPHETKSPEIHVTNPKQGKRLNFTQSYSLQLSNLKMEDTGSYRAQISTKTSAKLSSYTLRILRQLRNIQVTNHSQLFQNMTCELHLTCSVEDADDNVSFRWEALGNTLSSQPNLTVSWDPRISSEQDYTCIAENAVSNLSFSVSAQKLCEDVKIQYTDTKMILFMVSGICIVFGFIILLLLVLRKRRDSLSLSTQRTQGPAESARNLEYVSVSPTNNTVYASVTHSNRETEIWTPRENDTITIYSTINHSKESKPTFSRATALDNVV 46D8141A0D198091 w6s5e5tuctr-1 2 5 unspecified role unspecified role bait bait region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 7 unspecified role unspecified role prey prey human-jurkat Homo sapiens jurkat Human T cell leukemia 6 unspecified role unspecified role prey prey human-jurkat Homo sapiens jurkat Human T cell leukemia association association 2B pervanadate - an inhibitor of tyrosine phosphatases sh2d1a-slamf6-1 2 5 unspecified role unspecified role bait bait region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 7 unspecified role unspecified role prey prey human-jurkat Homo sapiens jurkat Human T cell leukemia physical association physical association 2Bi NTB-A is phosphorylated and associates with SAP in non-activated cells and this association is increased upon activation. NTB-A is phosphorylated and associates with SAP in non-activated cells and this association is increased upon activation. sh2d1a-cd247-2 2 5 unspecified role unspecified role bait bait region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 6 unspecified role unspecified role prey prey human-t-lymphoblast Homo sapiens T-lymphoblast t-lymphoblast T-lymphoblast physical association physical association 2C mAb to CD3-zeta (UCHT-1) sh2d1a-cd247-4 1 5 unspecified role unspecified role bait bait region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 6 unspecified role unspecified role prey prey human-jurkat Homo sapiens jurkat Human T cell leukemia physical association physical association 3A pervanadate- an inhibitor of tyrosine phosphatases Not a "direct" interaction in our terms sh2d1a-cd247-3 3 5 unspecified role unspecified role prey prey 6 unspecified role unspecified role bait bait physical association physical association 3B Pervanadate (CHEBI:35607) - an inhibitor of tyrosine phosphatases sh2d1a-cd247-5 4 5 unspecified role unspecified role bait bait region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 6 unspecified role unspecified role prey prey P20963:p.[Tyr111Phe;Tyr123Phe] mutation with no effect mutation with no effect mutation with no effect mutation not affecting interaction certain certain sequence position certain certain certain sequence position certain Y F certain certain sequence position certain certain certain sequence position certain Y F Wed May 02 15:00:17 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'tyr111phe,tyr123phe' Tue Jun 30 18:01:35 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.[Tyr111Phe;Tyr123Phe]' P20963:p.[Tyr142Phe;Tyr153Phe] mutation with no effect mutation with no effect mutation with no effect mutation not affecting interaction certain certain sequence position certain certain certain sequence position certain Y F certain certain sequence position certain certain certain sequence position certain Y F Wed May 02 16:32:13 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'tyr142phe,tyr153phe' Tue Jun 30 17:39:16 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.[Tyr142Phe;Tyr153Phe]' P20963:p.Tyr72Phe mutation decreasing strength mutation decreasing interaction strength mutation decreasing strength certain certain sequence position certain certain certain sequence position certain Y F Wed May 02 15:06:53 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'tyr72phe' Tue Jun 30 18:59:24 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Tyr72Phe' P20963:p.Tyr83Phe mutation decreasing strength mutation decreasing interaction strength mutation decreasing strength certain certain sequence position certain certain certain sequence position certain Y F Wed May 02 16:30:26 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'tyr83phe' Tue Jun 30 20:12:21 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Tyr83Phe' c_terminus his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range c_terminus myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range P20963:p.[Tyr72Phe;Tyr83Phe] mutation disrupting strength mutation disrupting interaction strength mutation disrupting strength certain certain sequence position certain certain certain sequence position certain Y F certain certain sequence position certain certain certain sequence position certain Y F Wed May 02 16:58:13 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'tyr72phe,tyr83phe' Tue Jun 30 15:35:24 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.[Tyr72Phe;Tyr83Phe]' human-hela Homo sapiens epitheloid cervix carcinoma cells Human hela Human epitheloid cervix carcinoma HeLa cells derivation: cervix; epithelial; adenocarcinoma ATCC no:CCL-2 physical association physical association 4 B/C pervanadate- an inhibitor of tyrosine phosphatases