DIP Database of Interacting Proteins 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ dip@mbi.ucla.edu Molecular basis of bacterial protein Hen1 activating the ligase activity of bacterial protein Pnkp for RNA repair. Molecular basis of bacterial protein Hen1 activating the ligase activity of bacterial protein Pnkp for RNA repair. Proceedings of the National Academy of Sciences of the United States of America 2012 imex curation Wang P., Chan CM., Christensen D., Zhang C., Selvadurai K., Huang RH. Only protein-protein interactions in vitro In vitro molecular sieving molecular sieving Gel Filtration Size Exclusion Chromatography Size Exclusion Chromatography Gel Filtration Sizing column predetermined predetermined participant predetermined Wang P., Chan CM., Christensen D., Zhang C., Selvadurai K., Huang RH. DIP original experiment: DIP-251754X Proceedings of the National Academy of Sciences of the United States of America 2012 IMEx Molecular basis of bacterial protein Hen1 activating the ligase activity of bacterial protein Pnkp for RNA repair. Molecular basis of bacterial protein Hen1 activating the ligase activity of bacterial protein Pnkp for RNA repair. Molecular basis of bacterial protein Hen1 activating the ligase activity of bacterial protein Pnkp for RNA repair. Proceedings of the National Academy of Sciences of the United States of America 2012 imex curation Wang P., Chan CM., Christensen D., Zhang C., Selvadurai K., Huang RH. Only protein-protein interactions ecolx Escherichia coli molecular sieving molecular sieving Gel Filtration Size Exclusion Chromatography Size Exclusion Chromatography Gel Filtration Sizing column predetermined predetermined participant predetermined Wang P., Chan CM., Christensen D., Zhang C., Selvadurai K., Huang RH. DIP original experiment: DIP-251757X Proceedings of the National Academy of Sciences of the United States of America 2012 IMEx Molecular basis of bacterial protein Hen1 activating the ligase activity of bacterial protein Pnkp for RNA repair. Molecular basis of bacterial protein Hen1 activating the ligase activity of bacterial protein Pnkp for RNA repair. Molecular basis of bacterial protein Hen1 activating the ligase activity of bacterial protein Pnkp for RNA repair. Proceedings of the National Academy of Sciences of the United States of America 2012 imex curation Wang P., Chan CM., Christensen D., Zhang C., Selvadurai K., Huang RH. Only protein-protein interactions in vitro In vitro x-ray diffraction x-ray crystallography X-ray X-ray x-ray diffraction predetermined predetermined participant predetermined Wang P., Chan CM., Christensen D., Zhang C., Selvadurai K., Huang RH. DIP original experiment: DIP-251755X Proceedings of the National Academy of Sciences of the United States of America 2012 IMEx Molecular basis of bacterial protein Hen1 activating the ligase activity of bacterial protein Pnkp for RNA repair. Molecular basis of bacterial protein Hen1 activating the ligase activity of bacterial protein Pnkp for RNA repair. Molecular basis of bacterial protein Hen1 activating the ligase activity of bacterial protein Pnkp for RNA repair. Proceedings of the National Academy of Sciences of the United States of America 2012 imex curation Wang P., Chan CM., Christensen D., Zhang C., Selvadurai K., Huang RH. Only protein-protein interactions ecolx Escherichia coli x-ray diffraction x-ray crystallography X-ray X-ray x-ray diffraction predetermined predetermined participant predetermined Wang P., Chan CM., Christensen D., Zhang C., Selvadurai K., Huang RH. DIP original experiment: DIP-251756X Proceedings of the National Academy of Sciences of the United States of America 2012 IMEx Molecular basis of bacterial protein Hen1 activating the ligase activity of bacterial protein Pnkp for RNA repair. a3dj38_acet2 Cthe_2768 protein protein cloth Clostridium thermocellum (strain ATCC 27405 / DSM 1237) Ruminiclostridium thermocellum MKLTIPELSLVVLIGSSGSGKSTFAKKHFKPTEVISSDFCRGLVSDDENDQTVTGAAFDVLHYIVSKRLQLGKLTVVDATNVQESARKPLIEIAKDYHCFPVAVVFNLPEKVCQERNKNRTDRQVEEYVIRKHTQQLKKSIKGLQREGFRYVYILNSPEEVEEVVFERQPLWNNKKDEHGPFDIIGDIHGCYDELKMLLEKLGYLIEEVEGGVGSGKYRVTHPEGRKVLFLGDLVDRGPKITEVLKLVMGMVKSGIALCVPGNHDVKLLRKLNGRDVQITHGLDRTLEQLAKEPQEFIEEVKAFIDGLVSHYVLDDGKLVVAHAGMKEEFQGRGSGKVREFALYGETTGETDEYGLPVRYDWASDYRGKALVVYGHTPQAEVLKVNNTINIDTGCVFGGKLTAYRYPEREIVDVKALKTYYEPAKPFLPKEDMAERFEARTDNDILDINDVLGKKIITTRLMSSITIHEENSIAALEVMSRFAADPHWLIYLPPTMSPCETSKKEGMLEHPIEAFEYFRTRGVGKVVCEQKHMGSRAVVIVCKDSQVAEKRFGVLDGTAGICYTRTGRHFFDDMQLEAELIDRVRKVLDKSGFWGDFNTDWVCLDCELMPWSAKAQKLLEEQYSAVGISGRVVLDEAVKLLKQASLNKTVSFDVSRQTSGKNADINELLQRFTERSEMMQKYVEAYRKYCWPVNSIDDLKLAPFHILATEGKVHSDKNHIWHMDTIAKYCTQDDSLIMATNHILVDVTDAESVDKGIKWWEDLTASGGEGMVVKPYDFIVKNGRELLQPAVKCRGREYLRIIYGPEYTMDENIERLRNRAVGKKRSLALREFSLGMEALERFVRNEPLYRVHECVFGVLALESEPVDPRL DIP protein A3DJ38 original sequence version: 46 a3dj37_acet2 Cthe_2767 protein protein cloth Clostridium thermocellum (strain ATCC 27405 / DSM 1237) Ruminiclostridium thermocellum MILTITYTQPPATDLGYLLHKNPSRPQTFELNHGKAHIFYPEATSERCTVALLLDIDPIDLARGKKGSSGEGGLFDYVNDRPYVSSSFMSVAISRVFGTAMSGKCKEKPELAAIKLPLKAKIMMLPCKGGEEIIYRLFEPLGYKVDVEGYMLDEKFPEWGKSRYYTVSLEGEVRVRDLLNHIYVLIPVLDSEKHYWVGEDEIDKLFQHGEGWLVDHPEKELITGRYLIRKKRLVNQALKRLLEASDVVDDENEDDEPLKNEETEKKLNLNQQRLGTVVAVLKSVNAKKVIDLGCGEGNLLSLLLKDKSFEQITGVDVSYSVLERAKDRLKIDRLPEMQRKRISLFQSSLVYRDKRFSGYDAATVIEVIEHLDENRLQAFEKVLFEFTRPQTVIVSTPNKEYNFHYQNLFEGNLRHRDHRFEWTRKEFETWAVKVAEKYGYSVRFLQIGEIDDEFGSPTQMGVFTL DIP protein A3DJ37 original sequence version: 36 a3dj37_cloth-1 4 6 unspecified role unspecified role unspecified role unspecified role Region 1-230 Region 1-230 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain ecolx Escherichia coli direct interaction direct interaction a3dj37_cloth-a3dj38_cloth-1 1 5 unspecified role unspecified role unspecified role unspecified role Region 444-870 Region 444-870 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain ecolx Escherichia coli 6 unspecified role unspecified role unspecified role unspecified role Region 1-230 Region 1-230 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain ecolx Escherichia coli direct interaction direct interaction a3dj37_cloth-2 2 6 unspecified role unspecified role unspecified role unspecified role Region 1-230 Region 1-230 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain ecolx Escherichia coli direct interaction direct interaction a3dj37_cloth-a3dj38_cloth-2 3 6 unspecified role unspecified role unspecified role unspecified role Region 1-230 Region 1-230 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain ecolx Escherichia coli 5 unspecified role unspecified role unspecified role unspecified role Region 444-870 Region 444-870 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain ecolx Escherichia coli direct interaction direct interaction