DIP Database of Interacting Proteins 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ dip@mbi.ucla.edu Interaction between BZR1 and PIF4 integrates brassinosteroid and environmental responses. Interaction between BZR1 and PIF4 integrates brassinosteroid and environmental responses. Nature cell biology 2012 imex curation Oh E., Zhu JY., Wang ZY. Only protein-protein interactions in vitro In vitro pull down pull down anti tag western anti tag western blot anti tag western Oh E., Zhu JY., Wang ZY. DIP original experiment: DIP-268124X Nature cell biology 2012 IMEx Interaction between BZR1 and PIF4 integrates brassinosteroid and environmental responses. Interaction between BZR1 and PIF4 integrates brassinosteroid and environmental responses. Interaction between BZR1 and PIF4 integrates brassinosteroid and environmental responses. Nature cell biology 2012 imex curation Oh E., Zhu JY., Wang ZY. Only protein-protein interactions nicbe Nicotiana benthamiana bifc bimolecular fluorescence complementation bifc predetermined predetermined participant predetermined Oh E., Zhu JY., Wang ZY. DIP original experiment: DIP-268120X Nature cell biology 2012 IMEx Interaction between BZR1 and PIF4 integrates brassinosteroid and environmental responses. Interaction between BZR1 and PIF4 integrates brassinosteroid and environmental responses. Interaction between BZR1 and PIF4 integrates brassinosteroid and environmental responses. Nature cell biology 2012 imex curation Oh E., Zhu JY., Wang ZY. Only protein-protein interactions arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress anti tag coip anti tag coimmunoprecipitation anti tag coip anti tag western anti tag western blot anti tag western Oh E., Zhu JY., Wang ZY. DIP original experiment: DIP-268122X Nature cell biology 2012 IMEx Interaction between BZR1 and PIF4 integrates brassinosteroid and environmental responses. Interaction between BZR1 and PIF4 integrates brassinosteroid and environmental responses. Interaction between BZR1 and PIF4 integrates brassinosteroid and environmental responses. Nature cell biology 2012 imex curation Oh E., Zhu JY., Wang ZY. Only protein-protein interactions nicbe Nicotiana benthamiana bifc bimolecular fluorescence complementation bifc predetermined predetermined participant predetermined Oh E., Zhu JY., Wang ZY. DIP original experiment: DIP-268121X Nature cell biology 2012 IMEx Interaction between BZR1 and PIF4 integrates brassinosteroid and environmental responses. Interaction between BZR1 and PIF4 integrates brassinosteroid and environmental responses. Interaction between BZR1 and PIF4 integrates brassinosteroid and environmental responses. Nature cell biology 2012 imex curation Oh E., Zhu JY., Wang ZY. Only protein-protein interactions in vitro In vitro pull down pull down predetermined predetermined participant predetermined Oh E., Zhu JY., Wang ZY. DIP original experiment: DIP-268125X Nature cell biology 2012 IMEx Interaction between BZR1 and PIF4 integrates brassinosteroid and environmental responses. Interaction between BZR1 and PIF4 integrates brassinosteroid and environmental responses. Interaction between BZR1 and PIF4 integrates brassinosteroid and environmental responses. Nature cell biology 2012 imex curation Oh E., Zhu JY., Wang ZY. Only protein-protein interactions in vitro In vitro pull down pull down anti tag western anti tag western blot anti tag western Oh E., Zhu JY., Wang ZY. DIP original experiment: DIP-268123X Nature cell biology 2012 IMEx Interaction between BZR1 and PIF4 integrates brassinosteroid and environmental responses. Interaction between BZR1 and PIF4 integrates brassinosteroid and environmental responses. Interaction between BZR1 and PIF4 integrates brassinosteroid and environmental responses. Nature cell biology 2012 imex curation Oh E., Zhu JY., Wang ZY. Only protein-protein interactions in vitro In vitro pull down pull down anti tag western anti tag western blot anti tag western Oh E., Zhu JY., Wang ZY. DIP original experiment: DIP-268126X Nature cell biology 2012 IMEx Interaction between BZR1 and PIF4 integrates brassinosteroid and environmental responses. bzr1_arath Protein BRASSINAZOLE-RESISTANT 1 BZR1 BIS2 Protein BIN2 SUBSTRATE 2 F9E10_7 At1g75080 protein protein arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress MTSDGATSTSAAAAAAAAAAARRKPSWRERENNRRRERRRRAVAAKIYTGLRAQGDYNLPKHCDNNEVLKALCVEAGWVVEEDGTTYRKGCKPLPGEIAGTSSRVTPYSSQNQSPLSSAFQSPIPSYQVSPSSSSFPSPSRGEPNNNMSSTFFPFLRNGGIPSSLPSLRISNSCPVTPPVSSPTSKNPKPLPNWESIAKQSMAIAKQSMASFNYPFYAVSAPASPTHRHQFHTPATIPECDESDSSTVDSGHWISFQKFAQQQPFSASMVPTSPTFNLVKPAPQQMSPNTAAFQEIGQSSEFKFENSQVKPWEGERIHDVGMEDLELTLGNGKARG DIP protein Q8S307 original sequence version: 89 DIP protein Q8S307 original sequence version: 60 2CE6D6647D72C012 bzr2_arath Protein BRASSINAZOLE-RESISTANT 2 BZR2 BES1 BIS1 At1g19350 F18O14_4 Protein BRI1-EMS-SUPPRESSOR 1 Protein BIN2 SUBSTRATE 1 Protein 107 protein protein arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress MTSDGATSTSAAAAAAAMATRRKPSWRERENNRRRERRRRAVAAKIYTGLRAQGNYNLPKHCDNNEVLKALCSEAGWVVEEDGTTYRKGHKPLPGDMAGSSSRATPYSSHNQSPLSSTFDSPILSYQVSPSSSSFPSPSRVGDPHNISTIFPFLRNGGIPSSLPPLRISNSAPVTPPVSSPTSRNPKPLPTWESFTKQSMSMAAKQSMTSLNYPFYAVSAPASPTHHRQFHAPATIPECDESDSSTVDSGHWISFQKFAQQQPFSASMVPTSPTFNLVKPAPQQLSPNTAAIQEIGQSSEFKFENSQVKPWEGERIHDVAMEDLELTLGNGKAHS DIP protein Q9LN63 original sequence version: 82 DIP protein Q9LN63 original sequence version: 47 DIP protein Q9LN63 original sequence version: 60 DIP protein Q9LN63 original sequence version: 79 DIP protein Q9LN63 original sequence version: 99 7B0AA929FED4748B pif1_arath Transcription factor PIF1 EN101 BHLH15 PIL5 Protein PHY-INTERACTING FACTOR 1 Protein PHYTOCHROME INTERACTING FACTOR 3-LIKE 5 Transcription factor EN 101 bHLH transcription factor bHLH015 Basic helix-loop-helix protein 15 T2G17.2 At2g20180 PIF1 protein protein arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress MHHFVPDFDTDDDYVNNHNSSLNHLPRKSITTMGEDDDLMELLWQNGQVVVQNQRLHTKKPSSSPPKLLPSMDPQQQPSSDQNLFIQEDEMTSWLHYPLRDDDFCSDLLFSAAPTATATATVSQVTAARPPVSSTNESRPPVRNFMNFSRLRGDFNNGRGGESGPLLSKAVVRESTQVSPSATPSAAASESGLTRRTDGTDSSAVAGGGAYNRKGKAVAMTAPAIEITGTSSSVVSKSEIEPEKTNVDDRKRKEREATTTDETESRSEETKQARVSTTSTKRSRAAEVHNLSERKRRDRINERMKALQELIPRCNKSDKASMLDEAIEYMKSLQLQIQMMSMGCGMMPMMYPGMQQYMPHMAMGMGMNQPIPPPSFMPFPNMLAAQRPLPTQTHMAGSGPQYPVHASDPSRVFVPNQQYDPTSGQPQYPAGYTDPYQQFRGLHPTQPPQFQNQATSYPSSSRVSSSKESEDHGNHTTG DIP protein Q8GZM7 original sequence version: 95 93572A0D4669D350 pif4_arath Transcription factor PIF4 Transcription factor EN 102 bHLH transcription factor bHLH009 Basic helix-loop-helix protein 9 Short under red-light 2 PIF4 BHLH9 SRL2 At2g43010 MFL8.13 EN102 Phytochrome-interacting factor 4 protein protein arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress MEHQGWSFEENYSLSTNRRSIRPQDELVELLWRDGQVVLQSQTHREQTQTQKQDHHEEALRSSTFLEDQETVSWIQYPPDEDPFEPDDFSSHFFSTMDPLQRPTSETVKPKSSPEPPQVMVKPKACPDPPPQVMPPPKFRLTNSSSGIRETEMEQYSVTTVGPSHCGSNPSQNDLDVSMSHDRSKNIEEKLNPNASSSSGGSSGCSFGKDIKEMASGRCITTDRKRKRINHTDESVSLSDAIGNKSNQRSGSNRRSRAAEVHNLSERRRRDRINERMKALQELIPHCSKTDKASILDEAIDYLKSLQLQLQVMWMGSGMAAAAASAPMMFPGVQPQQFIRQIQSPVQLPRFPVMDQSAIQNNPGLVCQNPVQNQIISDRFARYIGGFPHMQAATQMQPMEMLRFSSPAGQQSQQPSSVPTKTTDGSRLDH DIP protein Q8W2F3 original sequence version: 103 DIP protein Q8W2F3-1 original sequence version: 120 B4C081D0BF907C26 bzr1-pif4-1 3 11 unspecified role unspecified role prey prey Myc-tag Myc-tag myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress 8 unspecified role unspecified role bait bait CFP-tag CFP-tag cfp tag cyan fluorescent protein tag CFP cyan fluorescent protein cyan fluorescent protein CFP cfp tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress physical association physical association bzr1-pif1-1 2 10 unspecified role unspecified role unspecified role unspecified role nYFP-tag nYFP-tag nyfp nYFP c-term range C-terminal range c-term range c-term range C-terminal range c-term range nicbe Nicotiana benthamiana 8 unspecified role unspecified role unspecified role unspecified role cYFP-tag cYFP-tag cyfp cYFP c-term range C-terminal range c-term range c-term range C-terminal range c-term range nicbe Nicotiana benthamiana physical association physical association bzr1-pif4-2 1 11 unspecified role unspecified role prey prey GST-tag GST-tag gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range Region 1-253 Region 1-253 sufficient to bind sufficient binding region sufficient to bind deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain Region 254-430 Region 254-430 sufficient to bind sufficient binding region sufficient to bind deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain ecolx Escherichia coli 8 unspecified role unspecified role bait bait MBP-tag MBP-tag mbp tag maltose binding protein tag maltose binding protein tag maltose binding protein tag mbp tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range ecolx Escherichia coli direct interaction direct interaction pif4-bzr2-1 7 9 unspecified role unspecified role prey prey MBP-tag MBP-tag mbp tag maltose binding protein tag maltose binding protein tag maltose binding protein tag mbp tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range ecolx Escherichia coli 11 unspecified role unspecified role bait bait GST-tag GST-tag gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range ecolx Escherichia coli direct interaction direct interaction bzr1-pif1-2 6 10 unspecified role unspecified role prey prey GST-tag GST-tag gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range ecolx Escherichia coli 8 unspecified role unspecified role bait bait MBP-tag MBP-tag mbp tag maltose binding protein tag maltose binding protein tag maltose binding protein tag mbp tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range ecolx Escherichia coli direct interaction direct interaction pif4-bzr1-1 5 11 unspecified role unspecified role bait bait GST-tag GST-tag gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range ecolx Escherichia coli 8 unspecified role unspecified role prey prey MBP-tag MBP-tag mbp tag maltose binding protein tag maltose binding protein tag maltose binding protein tag mbp tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range Region 1-109 Region 1-109 sufficient to bind sufficient binding region sufficient to bind deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain ecolx Escherichia coli direct interaction direct interaction bzr1-pif4-3 4 11 unspecified role unspecified role unspecified role unspecified role nYFP-tag nYFP-tag nyfp nYFP c-term range C-terminal range c-term range c-term range C-terminal range c-term range nicbe Nicotiana benthamiana 8 unspecified role unspecified role unspecified role unspecified role cYFP-tag cYFP-tag cyfp cYFP c-term range C-terminal range c-term range c-term range C-terminal range c-term range nicbe Nicotiana benthamiana physical association physical association