IntAct European Bioinformatics Institute IntAct intact http://www.ebi.ac.uk/ http://www.ebi.ac.uk/intact/query/${ac} EBI-[0-9]+|IA:[0-9]+ INTerAction database (IntAct) provides an open source database and toolkit for the storage, presentation and analysis of molecular interactions. http://www.ebi.ac.uk/intact European Bioinformatics Institute; Wellcome Trust Genome Campus; Hinxton, Cambridge; CB10 1SD; United Kingdom http://www.ebi.ac.uk/intact/ Multimeric structures of HLA-G isoforms function through differential binding to LILRB receptors. Multimeric structures of HLA-G isoforms function through differential binding to LILRB receptors. Cellular and molecular life sciences : CMLS 2012 imex curation HoWangYin KY., Loustau M., Wu J., Alegre E., Daouya M., Caumartin J., Sousa S., Horuzsko A., Carosella ED., LeMaoult J., HoWangYin KY., Loustau M., Wu J., Alegre E., Daouya M., Caumartin J., Sousa S., Horuzsko A., Carosella ED., LeMaoult J., HoWangYin KY., Loustau M., Wu J., Alegre E., Daouya M., Caumartin J., Sousa S., Horuzsko A., Carosella ED., LeMaoult J., HoWangYin KY., Loustau M., Wu J., Alegre E., Daouya M., Caumartin J., Sousa S., Horuzsko A., Carosella ED., LeMaoult J. Joel.LeMaoult@cea.fr 19-Dec-2017: Contacted by IntAct-Help. Only protein-protein interactions imex curation human-m8 human M8 metastatic melanoma cell line Human m8 M8 metastatic melanoma cell line Provided by Dr F. Jotereau (INSERM U211, Nantes, France), electrophoresis electrophoretic mobility-based method electrophoresis western blot western blot Immuno blot Immuno blot HoWangYin KY., Loustau M., Wu J., Alegre E., Daouya M., Caumartin J., Sousa S., Horuzsko A., Carosella ED., LeMaoult J., HoWangYin KY., Loustau M., Wu J., Alegre E., Daouya M., Caumartin J., Sousa S., Horuzsko A., Carosella ED., LeMaoult J., HoWangYin KY., Loustau M., Wu J., Alegre E., Daouya M., Caumartin J., Sousa S., Horuzsko A., Carosella ED., LeMaoult J., HoWangYin KY., Loustau M., Wu J., Alegre E., Daouya M., Caumartin J., Sousa S., Horuzsko A., Carosella ED., LeMaoult J. This experiment relates to a negative interaction It is not shown if B2M is present or not. I have linked this negative interactions to isoform-1 in the positive expt. total proteins from M8 transfectants (lysates) were immunoprecipitated followed by non-reducing SDS-PAGE. Joel.LeMaoult@cea.fr Accepted 2017-NOV-15 AT 09:53 GMT AT 09:53 GMT by ORCHARD Cellular and molecular life sciences : CMLS 2012 imex curation p17693-3 HLA class I histocompatibility antigen, alpha chain G HLA G antigen MHC class I antigen G HLA-G3 HLA-G HLA-6.0 HLAG protein protein human Homo sapiens Human MVVMAPRTLFLLLSGALTLTETWAGSHSMRYFSAAVSRPGRGEPRFIAMGYVDDTQFVRFDSDSACPRMEPRAPWVEQEGPEYWEEETRNTKAHAQTDRMNLQTLRGYYNQSEAKQSSLPTIPIMGIVAGLVVLAAVVTGAAVAAVLWRKKSSD CECFCC7616238134 hla_g-12 1 2 unspecified role unspecified role neutral component neutral component physical association physical association true 2B homodimers of HLA-G3 (alpha1 domain, lane 4) were never observed